PITPNM3 Antibody - BSA Free

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-33894] -Analysis in human spleen and pancreas tissues using NBP2-33894 antibody. Corresponding PITPNM3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-33894] - Staining of human cerebral cortex, kidney, liver and spleen using Anti-PITPNM3 antibody NBP2-33894 (A) shows similar protein distribution across tissues to independent antibody NBP2-34121 (B).

Immunocytochemistry/Immunofluorescence: PITPNM3 Antibody [NBP2-33894] - Staining of human cell line HeLa shows localization to plasma membrane.

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-33894] - Staining of human spleen shows strong membranous positivity in sinusoids.

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-33894] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-33894] -Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: PITPNM3 Antibody [NBP2-33894] -Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PITPNM3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PITPNM3 Antibody - BSA Free (NBP2-33894) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-PITPNM3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RFPLGDGQSLLLADALHTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPDV
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNM3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PITPNM3 Recombinant Protein Antigen (NBP2-33894PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PITPNM3 Antibody - BSA Free

• membrane-associated phosphatidylinositol transfer protein 3
• MGC157740
• MGC157741
• NIR-1
• NIR1CORD5
• Phosphatidylinositol transfer protein, membrane-associated 3
• PITPnm 3
• PITPNM family member 3
• Pyk2 N-terminal domain-interacting receptor 1
• RDGBA3
• retinal degeneration B alpha 3

Background

PITPNM3 is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application. NIR1 is calcium ion binding, has phosphatidylinositol transporter activity and receptor tyrosine kinase binding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PITPNM3 Antibody (NBP2-33894)(1)

Publication using NBP2-33894

• Sui X, Chen C, Zhou X et al. Integrative analysis of bulk and single-cell gene expression profiles to identify tumor-associated macrophage-derived CCL18 as a therapeutic target of esophageal squamous cell carcinoma Journal of experimental & clinical cancer research : CR 2023-02-27 [PMID: 36850011] (IHC)

Bioinformatics

• Gene Symbol: PITPNM3
• Uniprot:
  • Q9BZ71(Human)