NIPP1 Antibody

Images

 
Western Blot: NIPP1 Antibody [NBP1-90112] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: NIPP1 Antibody [NBP1-90112] - Staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: NIPP1 Antibody [NBP1-90112] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Western Blot: NIPP1 Antibody [NBP1-90112] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NIPP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:THSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NIPP1 Protein (NBP1-90112PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NIPP1 Antibody

  • activator of RNA decay
  • ARD1
  • ard-1
  • ARD1nuclear inhibitor of protein phosphatase 1
  • NIPP1
  • NIPP1nuclear inhibitor of protein phosphatase-1
  • NIPP-1nuclear subunit of PP-1
  • PPP1R8
  • PRO2047
  • Protein phosphatase 1 regulatory inhibitor subunit 8
  • protein phosphatase 1 regulatory subunit 8
  • protein phosphatase 1, regulatory (inhibitor) subunit 8
  • RNase E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24490
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-19461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90112
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NIPP1 Antibody (NBP1-90112) (0)

There are no publications for NIPP1 Antibody (NBP1-90112).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIPP1 Antibody (NBP1-90112) (0)

There are no reviews for NIPP1 Antibody (NBP1-90112). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NIPP1 Antibody (NBP1-90112). (Showing 1 - 2 of 2 FAQ).

  1. Could you please send me the exact immunogen sequence for NBP1-56106?
    • The immunogen sequence for NBP1-56106 is proprietary and cannot be disclosed. Please note that this antibody has been validated and is therefore guaranteed for use in human, mouse and rat.
  2. Does NBP1-56106 recognize all 3 NIPP1 isoforms?
    • We have not tested the antibody for specificity of different isoforms of the protein, it recognizes total endogenous NIPP1 protein.

Secondary Antibodies

 

Isotype Controls

Additional NIPP1 Products

Bioinformatics Tool for NIPP1 Antibody (NBP1-90112)

Discover related pathways, diseases and genes to NIPP1 Antibody (NBP1-90112). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIPP1 Antibody (NBP1-90112)

Discover more about diseases related to NIPP1 Antibody (NBP1-90112).
 

Pathways for NIPP1 Antibody (NBP1-90112)

View related products by pathway.

PTMs for NIPP1 Antibody (NBP1-90112)

Learn more about PTMs related to NIPP1 Antibody (NBP1-90112).

Blogs on NIPP1

There are no specific blogs for NIPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIPP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R8
Entrez