NgR3/NgRH2/RTN4RL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NgR3/NgRH2/RTN4RL1 Antibody [NBP1-92359] - Staining of human stomach (upper) shows strong cytoplasmic and membranous positivity in glandular cells.

Staining of human stomach (upper) shows strong cytoplasmic and membranous positivity in glandular cells.

Nogo-B promotes NPC cell migration by regulating RhoA-SRF-MRTFA.A The STRING database showed that Nogo-B and RhoA were associated. B Real-time PCR showed that RhoA, MRTFA, and SRF were highly expressed in TW03 (left) and HK1 (right) cell lines overexpressing Nogo-B and NgR3. C Western blotting showed that RhoA-GTP, MRTFA, and SRF were highly expressed in TW03 (left) and HK1 (right) cell lines overexpressing Nogo-B and NgR3. D Immunohistochemistry showed that overexpressing NgR3 and Nogo-B upregulated p-RhoA expression in metastatic mouse lung xenografts. E After treatment with CCG-1423(30 μmol/L) for 24 h, the expression of FAK and N-Cadherin decreased in HK1 cell lines. F The average number of migrated cells in three fields of HK1 cell lines with overexpressing Nogo-B or NgR3 decreased after using CCG-1423(30 μmol/L). G The average number of invaded cells in three fields of HK1 cell lines with overexpressing Nogo-B or NgR3 decreased after using CCG-1423(30 μmol/L). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/35075114), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NgR3/NgRH2/RTN4RL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RTN4RL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval method is recommended.
• Control Peptide:

  NgR3/NgRH2/RTN4RL1 Protein (NBP1-92359PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NgR3/NgRH2/RTN4RL1 Antibody - BSA Free

• DKFZp547J144
• NgR3
• NgRH2
• NGRL2
• nogo receptor-like 2
• Nogo-66 receptor homolog 2
• Nogo-66 receptor-related protein 3
• reticulon 4 receptor-like 1
• reticulon-4 receptor-like 1
• RTN4RL1

Background

RTN4RL1 may play a role in regulating axonal regeneration and plasticity in the adult central nervous system

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NgR3/NgRH2/RTN4RL1 Antibody (NBP1-92359)(2)

Publications using NBP1-92359

• Wang J, Zhong Q, Zhang H et al. Nogo-B promotes invasion and metastasis of nasopharyngeal carcinoma via RhoA-SRF-MRTFA pathway Cell death & disease 2022-01-24 [PMID: 35075114] (Human)
• He JY, Han P, Zhang Y et al. Overexpression of Nogo receptor 3 (NgR3) correlates with poor prognosis and contributes to the migration of epithelial cells of nasopharyngeal carcinoma patients J. Mol. Med. 2018-01-11 [PMID: 29327067] (Human)

Bioinformatics

• Gene Symbol: RTN4RL1
• Entrez:
  • 146760(Human)
• Uniprot:
  • Q86UN2()