NFKBIL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NFKBIL2 Antibody [NBP1-87764] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: NFKBIL2 Antibody [NBP1-87764] - Staining of human skeletal muscle shows moderate cytoplasmic positivity.
Immunocytochemistry/ Immunofluorescence: NFKBIL2 Antibody [NBP1-87764] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFKBIL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WNRRNDMGETLLHRACIEGQLRRVQDLVRQGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGGQGCEGITPLHDALNCGHFEVAELLLERGASVTLRTRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TONSL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NFKBIL2 Protein (NBP1-87764PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFKBIL2 Antibody

  • IkappaBR
  • I-kappa-B-related protein
  • IKBRFLJ40087
  • Inhibitor of kappa B-related protein
  • NF-kappa-B inhibitor-like protein 2
  • NFKBIL2tonsoku-like protein
  • Nuclear factor of kappa light polypeptide gene enhancer in B-cellsinhibitor-like 2ikappaBR
  • tonsoku-like, DNA repair protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-57743
Species: Hu
Applications: ICC/IF
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-56390
Species: Mu
Applications: WB
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
MAB2698
Species: Hu
Applications: WB, IHC, ICC
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NFKBIL2 Antibody (NBP1-87764) (0)

There are no publications for NFKBIL2 Antibody (NBP1-87764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFKBIL2 Antibody (NBP1-87764) (0)

There are no reviews for NFKBIL2 Antibody (NBP1-87764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NFKBIL2 Antibody (NBP1-87764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFKBIL2 Products

Bioinformatics Tool for NFKBIL2 Antibody (NBP1-87764)

Discover related pathways, diseases and genes to NFKBIL2 Antibody (NBP1-87764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFKBIL2 Antibody (NBP1-87764)

Discover more about diseases related to NFKBIL2 Antibody (NBP1-87764).
 

Pathways for NFKBIL2 Antibody (NBP1-87764)

View related products by pathway.

PTMs for NFKBIL2 Antibody (NBP1-87764)

Learn more about PTMs related to NFKBIL2 Antibody (NBP1-87764).

Blogs on NFKBIL2

There are no specific blogs for NFKBIL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFKBIL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TONSL