NFkB1/NFkB p105 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit NFkB1/NFkB p105 Antibody - BSA Free (NBP3-10287) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NFkB1/NFkB p105 (NP_003989). Peptide sequence LRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGK |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NFKB1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
105 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for NFkB1/NFkB p105 Antibody - BSA Free
Background
Nuclear factor kappa beta (NFKB) is a transcription factor that is highly influenced by stress, free-radicals, UV light and hypoxia. Unsurprisingly, NFKB is essential for many human cancers, as it regulates the expression of many downstream proteins that regulate or modify cellular growth and development. NFKB effects on angiogenic pathways and reactive mechanisms to stress and damage are well established throughout literature. Atherosclerosis is partly attributed to the mis-regulation of NFKB in hypoxia. Arthritis is related to inflammation proteins regulated through NFKB. It also has been shown to be important in synapses in brain, leading to memory and cognitive ability or impairment. In all, NFKB is one of the fastest responding transcription factors in humans, and is likely to mediate many responsive events in diseases and injury recovery.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: WB
Publications for NFkB1/NFkB p105 Antibody (NBP3-10287) (0)
There are no publications for NFkB1/NFkB p105 Antibody (NBP3-10287).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NFkB1/NFkB p105 Antibody (NBP3-10287) (0)
There are no reviews for NFkB1/NFkB p105 Antibody (NBP3-10287).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NFkB1/NFkB p105 Antibody (NBP3-10287) (0)