NFkB1/NFkB p105 Antibody - BSA Free

Western Blot: NFkB1/NFkB p105 Antibody [NBP3-10287] - Western blot analysis using NBP3-10287 on Human THP-1 as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NFkB1/NFkB p105 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFkB1/NFkB p105 (NP_003989). Peptide sequence LRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGK
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFKB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 105 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NFkB1/NFkB p105 Antibody - BSA Free

• DNA-binding factor KBF1
• EBP-1
• NF-kappa-B
• NFkB1
• NF-kB1
• NFKB-p105
• Nuclear factor NF-kappa-B p105 subunit
• Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
• p105

Background

Nuclear factor kappa beta (NFKB) is a transcription factor that is highly influenced by stress, free-radicals, UV light and hypoxia. Unsurprisingly, NFKB is essential for many human cancers, as it regulates the expression of many downstream proteins that regulate or modify cellular growth and development. NFKB effects on angiogenic pathways and reactive mechanisms to stress and damage are well established throughout literature. Atherosclerosis is partly attributed to the mis-regulation of NFKB in hypoxia. Arthritis is related to inflammation proteins regulated through NFKB. It also has been shown to be important in synapses in brain, leading to memory and cognitive ability or impairment. In all, NFKB is one of the fastest responding transcription factors in humans, and is likely to mediate many responsive events in diseases and injury recovery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFKB1