NFkB p105/p50 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining in human lymph node and cerebral cortex tissues using NBP1-87758 antibody. Corresponding NFKB1 RNA-seq data are ...read more
Genetic Strategies: Western Blot: NFkB p105/p50 Antibody [NBP1-87758] - Analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NFKB1 antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Western Blot: NFkB p105/p50 Antibody [NBP1-87758] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human colon shows moderate cytoplasmic positivity in glandular and lymphoid cells.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human lymph node shows strong cytoplasmic positivity in germinal- and non-germinal center cells.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody [NBP1-87758] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFkB p105/p50 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFKB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NFkB p105/p50 Protein (NBP1-87758PEP)
Publications
Read Publications using
NBP1-87758 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFkB p105/p50 Antibody

  • DKFZp686C01211
  • DNA binding factor KBF1
  • DNA-binding factor KBF1
  • EBP-1
  • KBF1
  • NF-kappaB
  • NF-kappa-B
  • NF-kappabeta
  • NFKB-p105
  • NFKB-p50
  • nuclear factor kappa-B DNA binding subunit
  • nuclear factor NF-kappa-B p105 subunit
  • nuclear factor NF-kappa-B p50 subunit
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151
  • p105
  • p50

Background

NFkB is a transcription regulator that is activated by various intra and extra cellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Serine 529 is located in a negatively charged region (amino acids 422-540) that is phosphorylated in response to phorbol myristate acetate plus calcium ionophore activation. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-91499
Species: Bv, Mu
Applications: IHC, IHC-P, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB5526
Species: Hu, Mu
Applications: WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF2699
Species: Hu, Mu
Applications: ChIP, ICC, Simple Western, WB
NBP1-87758
Species: Hu
Applications: WB, ICC/IF, IHC, KD

Publications for NFkB p105/p50 Antibody (NBP1-87758)(2)

Reviews for NFkB p105/p50 Antibody (NBP1-87758) (0)

There are no reviews for NFkB p105/p50 Antibody (NBP1-87758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NFkB p105/p50 Antibody (NBP1-87758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFkB p105/p50 Products

Diseases for NFkB p105/p50 Antibody (NBP1-87758)

Discover more about diseases related to NFkB p105/p50 Antibody (NBP1-87758).
 

Pathways for NFkB p105/p50 Antibody (NBP1-87758)

View related products by pathway.

PTMs for NFkB p105/p50 Antibody (NBP1-87758)

Learn more about PTMs related to NFkB p105/p50 Antibody (NBP1-87758).
 

Research Areas for NFkB p105/p50 Antibody (NBP1-87758)

Find related products by research area.

Blogs on NFkB p105/p50.

Nuclear Factor kappa B Signaling in the Immune System
Nuclear Factor kappa B (NFkB) binds to the kappa-beta site of the immunoglobulin kappa light chain gene enhancer. Thus NFkB has become one of the widely studied transcription factors in innate and adaptive immune responses. The NFkB family is composed...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFkB p105/p50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKB1