NFATC3/NFAT4 Antibody (3A12) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: NFATC3/NFAT4 Antibody (3A12) [H00004775-M02] - Analysis of monoclonal antibody to NFATC3 on HeLa cell . Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: NFATC3/NFAT4 Antibody (3A12) [H00004775-M02] - Analysis of monoclonal antibody to NFATC3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml.

ELISA: NFATC3/NFAT4 Antibody (3A12) [H00004775-M02] - Detection limit for recombinant GST tagged NFATC3 is approximately 10ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, ICC/IF, IHC
• Clone: 3A12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NFATC3/NFAT4 Antibody (3A12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: NFATC3 (NP_775188, 70 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
• Specificity: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NFATC3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
• Application Notes: Antibody reactivity against recombinant protein on ELISA. It has been used for IHC-P.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NFATC3/NFAT4 Antibody (3A12) - Azide and BSA Free

• NFAT4
• NF-AT4
• NFAT4nuclear factor of activated T-cells, cytoplasmic 3
• NFATC3
• NF-ATc3
• NFATX
• nuclear factor of activated T-cells c3 isoform IE-Xa
• nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
• T cell transcription factor NFAT4
• T-cell transcription factor NFAT4

Background

The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFATC3
• Entrez:
  • 4775(Human)
• OMIM:
  • 602698(Human)
• Uniprot:
  • NP_775188(Human)