NFATC2IP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NFATC2IP Antibody [NBP2-58210] - Staining of human cell line HeLa shows localization to nucleus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFATC2IP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFATC2IP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NFATC2IP Recombinant Protein Antigen (NBP2-58210PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NFATC2IP Antibody - BSA Free

• 45 kDa NF-AT-interacting protein
• ESC2
• FLJ14639
• MGC126790
• MGC138387
• NFATC2-interacting protein
• NIP4545 kDa NFAT-interacting protein
• Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein
• nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2interacting protein
• RAD60

Background

NFATC2IP plays a role in the inducible expression of cytokine genes in T-cells, especially by increasing NFAT-drivenIL-4 production

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFATC2IP