NF-M Antibody (2705)

Images

 
Western Blot: NF-M Antibody (2705) [NBP2-46625] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry: NF-M Antibody (2705) [NBP2-46625] - Staining of human liver shows absence of immunoreactivity (negative control).
Western Blot: NF-M Antibody (2705) [NBP2-46625] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: NF-M Antibody (2705) [NBP2-46625] - Staining of rat brainstem shows strong immunoreactivity in mesencephalic trigeminal nucleus neurons.
Immunohistochemistry: NF-M Antibody (2705) [NBP2-46625] - Staining of mouse cerebral cortex shows strong immunoreactivity in neurofilaments.
Immunohistochemistry: NF-M Antibody (2705) [NBP2-46625] - Staining of human cerebellum shows strong immunoreactivity in Purkinje cells and neuronal processes.
Immunohistochemistry: NF-M Antibody (2705) [NBP2-46625] - Staining of rat cerebellum shows strong immunoreactivity in neuronal processes.
Immunohistochemistry: NF-M Antibody (2705) [NBP2-46625] - Staining of mouse trigeminal ganglion shows strong positivity in primary sensory neurons.
Immunohistochemistry: NF-M Antibody (2705) [NBP2-46625] - Staining of human cerebral cortex shows strong positivity in neural fibers.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
2705
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NF-M Antibody (2705) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Epitope
Binds to an epitope located within the peptide sequence SDHLEEDIHRLKERF as determined by overlapping synthetic peptides.
Specificity
Specificity of human, mouse, rat NF-M antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
NEFM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
NF-M Lysate (NBP2-66001)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for NF-M Antibody (2705)

  • NEF3
  • NEF3neurofilament medium polypeptide
  • NEFM
  • Neurofilament 3
  • neurofilament, medium polypeptide 150kDa
  • neurofilament, medium polypeptide
  • neurofilament-3 (150 kD medium)
  • NFM
  • NF-M
  • NF-M160 kDa neurofilament protein
  • NFMNeurofilament triplet M protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-135
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NB300-140
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IF
NB300-137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF3844
Species: Hu, Mu
Applications: IHC
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF3795
Species: Hu
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for NF-M Antibody (NBP2-46625) (0)

There are no publications for NF-M Antibody (NBP2-46625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NF-M Antibody (NBP2-46625) (0)

There are no reviews for NF-M Antibody (NBP2-46625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NF-M Antibody (NBP2-46625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NF-M Antibody (NBP2-46625)

Discover related pathways, diseases and genes to NF-M Antibody (NBP2-46625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF-M Antibody (NBP2-46625)

Discover more about diseases related to NF-M Antibody (NBP2-46625).
 

Pathways for NF-M Antibody (NBP2-46625)

View related products by pathway.

PTMs for NF-M Antibody (NBP2-46625)

Learn more about PTMs related to NF-M Antibody (NBP2-46625).
 

Research Areas for NF-M Antibody (NBP2-46625)

Find related products by research area.

Blogs on NF-M

There are no specific blogs for NF-M, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NF-M Antibody (2705) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEFM
Entrez
Uniprot