Neurotrypsin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: WVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PRSS12 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Neurotrypsin Antibody - BSA Free
Background
Neurotrypsin is a central nervous system-expressed serine protease whose truncation or absence causes nonsyndromic mental retardation. It is most prominently expressed in structures that are involved in the processing and storage of learned behavior and memory, such as the cerebral cortex, the hippocampus, and amygdala. Evidence suggests that neurotrypsin has multiple functions, including axonal outgrowth, maintaining neuronal plasticity, and arranging the perineuronal environment, partly in coordination with other proteases including tissue plasminogen activator. There are three sequences published for neurotrypsin to date; 875, 834 and 505 amino acids in length. The predicted masses are 97, 92.5 and 55.7 kDa respectively, with predicted pI of 9.14, 8.88 and 6.57. The three forms all start at the same place. The 505 residue form terminates in the last SRCR domain, before the catalytic domain, and the 834 amino acid form has a 40 amino acid deletion that starts just after the PC site, and includes the catalytic histidine, thus both species would be proteolytically inactive.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: ICC/IF, KD, KO, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IP, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Mu
Applications: IHC, IP, WB
Publications for Neurotrypsin Antibody (NBP2-38231) (0)
There are no publications for Neurotrypsin Antibody (NBP2-38231).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neurotrypsin Antibody (NBP2-38231) (0)
There are no reviews for Neurotrypsin Antibody (NBP2-38231).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Neurotrypsin Antibody (NBP2-38231) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neurotrypsin Products
Research Areas for Neurotrypsin Antibody (NBP2-38231)
Find related products by research area.
|
Blogs on Neurotrypsin