![Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Analysis in human cerebral cortex and liver tissues. Corresponding Neuronal Pentraxin R/NPTXR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Neuronal-Pentraxin-R-NPTXR-Antibody-Immunohistochemistry-Paraffin-NBP1-86531-img0010.jpg "Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Analysis in human cerebral cortex and liver tissues. Corresponding Neuronal Pentraxin R/NPTXR RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Neuronal Pentraxin R/NPTXR Antibody - BSA Free (NBP1-86531) is a polyclonal antibody validated for use in IHC. Anti-Neuronal Pentraxin R/NPTXR Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGILILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLVEAFGGATKAAFDVC |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPTXR |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
| Publication using NBP1-86531 | Applications | Species |
|---|---|---|
| Bartolini A, Di Paolo D, Noghero A et al. The Neuronal Pentraxin-2 Pathway Is an Unrecognized Target in Human Neuroblastoma, Which Also Offers Prognostic Value in Patients. Cancer Res. 2015-08-20 [PMID: 26294210] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPTXR |
![Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Neuronal-Pentraxin-R-NPTXR-Antibody-Immunohistochemistry-Paraffin-NBP1-86531-img0013.jpg "Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in a subset of neurons.](http://images.novusbio.com/fullsize/Neuronal-Pentraxin-R-NPTXR-Antibody-Immunohistochemistry-Paraffin-NBP1-86531-img0011.jpg "Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in a subset of neurons.")
![Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human colon shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Neuronal-Pentraxin-R-NPTXR-Antibody-Immunohistochemistry-Paraffin-NBP1-86531-img0012.jpg "Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human colon shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human lymph node shows no positivity as expected.](http://images.novusbio.com/fullsize/Neuronal-Pentraxin-R-NPTXR-Antibody-Immunohistochemistry-Paraffin-NBP1-86531-img0014.jpg "Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human lymph node shows no positivity as expected.")
![NPRA/NPR1 Antibody (488620) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "NPRA/NPR1 Antibody (488620) [Unconjugated]")
![Western Blot Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Western_Blot_12960.jpg)
![Immunohistochemistry Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Immunohistochemistry_14706.jpg)
![Immunocytochemistry Atrial Natriuretic Peptide/ANP Antibody [Unconjugated]](https://images.novusbio.com/images2/Atrial_Natriuretic_Peptide_AF3366_Immunocytochemistry_14709.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")