Neuronal Pentraxin R/NPTXR Antibody

Images

 
Immunohistochemistry-Paraffin: Neuronal Pentraxin R/NPTXR Antibody [NBP1-86531] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neuronal Pentraxin R/NPTXR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGILILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLVEAFGGATKAAFDVC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPTXR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuronal Pentraxin R/NPTXR Protein (NBP1-86531PEP)
Publications
Read Publication using
NBP1-86531 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuronal Pentraxin R/NPTXR Antibody

  • Neuronal Pentraxin R
  • neuronal pentraxin receptor
  • NPR
  • NPTXR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-31365
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
7707-NP
Species: Hu
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-76899
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531) (0)

There are no reviews for Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuronal Pentraxin R/NPTXR Products

Bioinformatics Tool for Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531)

Discover related pathways, diseases and genes to Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531)

Discover more about diseases related to Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531).
 

Pathways for Neuronal Pentraxin R/NPTXR Antibody (NBP1-86531)

View related products by pathway.

Blogs on Neuronal Pentraxin R/NPTXR

There are no specific blogs for Neuronal Pentraxin R/NPTXR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuronal Pentraxin R/NPTXR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPTXR
Entrez