Neuromedin-U Antibody

Images

 
Western Blot: Neuromedin-U Antibody [NBP1-87452] - Analysis in control (vector only transfected HEK293T lysate) and NMU over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Neuromedin-U Antibody [NBP1-87452] - Staining of human esophagus shows cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neuromedin-U Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuromedin-U Protein (NBP1-87452PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuromedin-U Antibody

  • neuromedin U
  • neuromedin-U

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02351
Species: Hu, Rt
Applications: EM, ELISA, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87515
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87515
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB8200
Species: Hu, Mu
Applications: IHC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
9134-TN
Species: Hu
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Neuromedin-U Antibody (NBP1-87452) (0)

There are no publications for Neuromedin-U Antibody (NBP1-87452).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuromedin-U Antibody (NBP1-87452) (0)

There are no reviews for Neuromedin-U Antibody (NBP1-87452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuromedin-U Antibody (NBP1-87452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuromedin-U Products

Bioinformatics Tool for Neuromedin-U Antibody (NBP1-87452)

Discover related pathways, diseases and genes to Neuromedin-U Antibody (NBP1-87452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuromedin-U Antibody (NBP1-87452)

Discover more about diseases related to Neuromedin-U Antibody (NBP1-87452).
 

Pathways for Neuromedin-U Antibody (NBP1-87452)

View related products by pathway.

Blogs on Neuromedin-U

There are no specific blogs for Neuromedin-U, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuromedin-U Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMU
Entrez
Uniprot