Neurokinin B Antibody - BSA Free

Western Blot: Neurokinin B Antibody [NBP1-92178] - Analysis in control (vector only transfected HEK293T lysate) and TAC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Neurokinin B Antibody [NBP1-92178] - Staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178] -Staining of human Placenta shows weak cytoplasmic positivity in syncytiotrophoblast.

Immunohistochemistry-Paraffin: Neurokinin B Antibody [NBP1-92178] -Staining of human Liver shows no positivity in hepatocytes as expected.

Immunocytochemistry/Immunofluorescence: Neurokinin B Antibody [NBP1-92178] -Staining of Mouse brain shows moderate positivity in cells in molecular layer in the cerebellum.

Staining of human Liver shows no positivity in hepatocytes as expected.

Immunofluorescence staining of Mouse brain shows moderate positivity in cells in molecular layer in the cerebellum.

Staining of human Cerebellum shows strong cytoplasmic positivity in Purkinje cells and neuronal processes.

Analysis in control (vector only transfected HEK293T lysate) and TAC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Staining of human Placenta shows weak cytoplasmic positivity in syncytiotrophoblast.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neurokinin B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neurokinin B Antibody - BSA Free (NBP1-92178) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAC3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  Neurokinin B Protein (NBP1-92178PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Neurokinin B Antibody - BSA Free

• gamma tachykinin 3
• neurokinin beta
• neurokinin B-like
• neuromedin K
• preprotachykinin B
• PRO1155
• tachykinin 3
• tachykinin-3
• ZNEUROK1NKNBNKB

Background

The Neurokinins, also known as Tachykinins, belong to an evolutionary conserved family of peptide neurotransmitters that share a c-terminal sequence and have an established role in neurotransmission. The mammalian tachykinins include substance P (NK1), neurokinin A (NKA) and neurokinin B (NKB) which exert their effects by binding to specific receptors. Tachykinin peptides are important in the mediation of many physiological and pathological processes including inflammation, pain, migraine headache and allergy induced asthma.

Three tachykinin receptor types have been characterized, NK-1, NK-2 and NK-3 which have preferential affinities for SP, NKA and NKB respectively. All three receptors share a high degree of sequence homology, have seven transmembrane spanning domains and similar signal transduction mechanisms (e.g. G-protein coupled activation of phospholipase C).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAC3