Neuroglycan C/CSPG5 Recombinant Protein Antigen

Images

 
There are currently no images for Neuroglycan C/CSPG5 Recombinant Protein Antigen (NBP2-56381PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Neuroglycan C/CSPG5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Neuroglycan C/CSPG5.

Source: E. coli

Amino Acid Sequence: GGVTAKAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CSPG5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56381.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neuroglycan C/CSPG5 Recombinant Protein Antigen

  • CALEB
  • chondroitin sulfate proteoglycan 5 (neuroglycan C)
  • chondroitin sulfate proteoglycan 5
  • CSPG5
  • MGC44034
  • Neuroglycan C
  • NGC
  • NGCAcidic leucine-rich EGF-like domain-containing brain protein

Background

Many cellular activities depend on the interaction of cells with the surrounding extracellular matrix (ECM). Most cells, in intact tissue and in culture, are attached to an ECM. Epithelial cells are associated with the basement membrane; fibroblastic cells are usually embedded in a pericellular mesh of fibrils, and tissue culture cells usually grow on a substrate which is covered by various ECM components. Studies have indicated that the matrix or its various isolated components provide not only adhesive surfaces for cells to grow on but also have effects on the rate of cell growth, mobility, morphogenesis and differentiation. Within the ECM several glycoproteins and proteoglycans have been identified. It has been proposed that the different constituents interact with each other in a rather complex fashion. The poor antigenicity of proteoglycans especially their glycoaminoglycan (GAG) moieties make it difficult to localize these molecules in tissue and cell culture. Monoclonal Anti-Chondroitin Sulfate can be used to study chondroitin sulfate proteoglycan (CSPG) distribution and its relationships to specific cell-substrate contacts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

236-EG
Species: Hu
Applications: BA
NB100-56414
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF5800
Species: Mu, Rt
Applications: IHC, WB
MAB2688
Species: Hu
Applications: WB
NBP1-81630
Species: Hu
Applications: IHC,  IHC-P
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
MAB1624
Species: Mu, Rt
Applications: IHC, WB
NBP1-88223
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
2914-HT
Species: Hu
Applications: BA
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for Neuroglycan C/CSPG5 Recombinant Protein Antigen (NBP2-56381PEP) (0)

There are no publications for Neuroglycan C/CSPG5 Recombinant Protein Antigen (NBP2-56381PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuroglycan C/CSPG5 Recombinant Protein Antigen (NBP2-56381PEP) (0)

There are no reviews for Neuroglycan C/CSPG5 Recombinant Protein Antigen (NBP2-56381PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neuroglycan C/CSPG5 Recombinant Protein Antigen (NBP2-56381PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neuroglycan C/CSPG5 Products

Research Areas for Neuroglycan C/CSPG5 Recombinant Protein Antigen (NBP2-56381PEP)

Find related products by research area.

Blogs on Neuroglycan C/CSPG5

There are no specific blogs for Neuroglycan C/CSPG5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neuroglycan C/CSPG5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CSPG5