Neurocan Recombinant Protein Antigen

Images

 
There are currently no images for Neurocan Protein (NBP1-84368PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Neurocan Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCAN.

Source: E. coli

Amino Acid Sequence: TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCAN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84368.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neurocan Recombinant Protein Antigen

  • chondroitin sulfate proteoglycan 3 (neurocan)
  • Chondroitin sulfate proteoglycan 3
  • CSPG3
  • CSPG3neurocan core protein
  • FLJ44681
  • NCAN
  • NEUR
  • neurocan proteoglycan
  • Neurocan

Background

Neurocan is the major soluble chondroitin sulfate proteoglycan in the brain. It is thought to play a functional role in axonal growth and guidance and in the establishment of specific neural pathways during embryonic brain development. Neurocan expression in the brain is developmentally regulated. Early on the major form of Neurocan consists of a 245kD core protein with approximately two chondroitin sulfate glycosoaminoglycan chains of 22kD each. Later Neurocan comprises a 180kD core protein Both forms of Neurocan contain only chondroitin 4-sulfate glycosoaminoglycan chains. By virtue of their high expression at sites of neural damage and trauma, chondroitin sulfate proteoglycans, including Neurocan, are thought to inhibit successful nerve regeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2688
Species: Hu
Applications: WB
NBP1-85432
Species: Hu, Mu
Applications: IHC,  IHC-P, mIF
AF4009
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-2688
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB1624
Species: Mu, Rt
Applications: IHC, WB
NBP2-94913
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4439
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP1-89020
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for Neurocan Protein (NBP1-84368PEP) (0)

There are no publications for Neurocan Protein (NBP1-84368PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurocan Protein (NBP1-84368PEP) (0)

There are no reviews for Neurocan Protein (NBP1-84368PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neurocan Protein (NBP1-84368PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurocan Products

Research Areas for Neurocan Protein (NBP1-84368PEP)

Find related products by research area.

Blogs on Neurocan

There are no specific blogs for Neurocan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neurocan Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAN