NEURL Antibody

Immunohistochemistry-Paraffin: NEURL Antibody [NBP1-92177] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Discontinued

NEURL Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVD
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEURL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NEURL Antibody

• h-neu
• h-neuralized 1
• neu
• neu-1
• neuralized (Drosophila)-like
• neuralized homolog (Drosophila)
• neuralized-like protein 1A
• NEURL1
• NEURL1A
• NEURL1neuralized-like (Drosophila)
• RING finger protein 67
• RNF67bA416N2.1

Background

NEURL is involved in the determination of cell fate in the neurogenic region of the embryo and plays a role in the determination of cell fate in the central nervous system. NEURL may act as a tumor suppressor whose inactivation could be associated with malignant progression of astrocytic tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEURL1