NEURL Antibody

Images

 
Immunohistochemistry-Paraffin: NEURL Antibody [NBP1-92177] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEURL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEURL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NEURL Protein (NBP1-92177PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEURL Antibody

  • h-neu
  • h-neuralized 1
  • neu
  • neu-1
  • neuralized (Drosophila)-like
  • neuralized homolog (Drosophila)
  • neuralized-like protein 1A
  • NEURL1A
  • NEURL1neuralized-like (Drosophila)
  • RING finger protein 67
  • RNF67bA416N2.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-92177
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for NEURL Antibody (NBP1-92177) (0)

There are no publications for NEURL Antibody (NBP1-92177).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEURL Antibody (NBP1-92177) (0)

There are no reviews for NEURL Antibody (NBP1-92177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NEURL Antibody (NBP1-92177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEURL Products

Bioinformatics Tool for NEURL Antibody (NBP1-92177)

Discover related pathways, diseases and genes to NEURL Antibody (NBP1-92177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEURL Antibody (NBP1-92177)

Discover more about diseases related to NEURL Antibody (NBP1-92177).
 

Pathways for NEURL Antibody (NBP1-92177)

View related products by pathway.

PTMs for NEURL Antibody (NBP1-92177)

Learn more about PTMs related to NEURL Antibody (NBP1-92177).
 

Research Areas for NEURL Antibody (NBP1-92177)

Find related products by research area.

Blogs on NEURL

There are no specific blogs for NEURL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEURL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEURL