Home » Neuregulin-2 » Neuregulin-2 Proteins » Neuregulin-2 Recombinant Protein Antigen

Neuregulin-2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Neuregulin-2 Protein (NBP1-87971PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Neuregulin-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NRG2.

Source: E.coli

Amino Acid Sequence: GSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMK
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NRG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87971.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Neuregulin-2 Recombinant Protein Antigen

  • divergent of neuregulin-1
  • DON1
  • Don-1
  • HRG2
  • neuregulin 2
  • NTAKneural- and thymus-derived activator for ErbB kinases
  • pro-neuregulin-2, membrane-bound isoform
  • pro-NRG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ErbB4/Her4 Antibody
NBP1-33120
Western Blot: ErbB4/Her4 Antibody [NBP1-33120] - Whole cell extract (30 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with Her4 / ErbB4 antibody [C1C3] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ErbB4/Her4 Antibody [NBP1-33120] - MCF-7 cells were fixed in ice-cold MeOH for 5 min. Green: ERBB4 protein stained by ERBB4 antibody [C1C3] diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: ErbB4/Her4 Antibody [NBP1-33120] - Paraffin-embedded NCIN87 xenograft, using antibody at 1:500 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(5 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Neuregulin-1 beta
1/NRG1 beta 1
396-HB
1 μg/lane of Recombinant Human NRG1-beta 1/HRG1-beta 1 EGF Domain was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 8 kDa.
Recombinant Human NRG1-beta 1/HRG1-beta 1 EGF Domain (Catalog # 396-HB) stimulates cell proliferation of the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.06-0.3 ng/mL.
(48 Publications)
Species: Hu
ErbB3/Her3
Antibody (66223)
MAB3481
Recombinant Human NRG1‑1 beta 1/HRG1‑1 beta 1 (Catalog # 377-HB) stimulates proliferation in the MCF‑17 human breast cancer cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human NRG1‑1 beta 1/HRG1‑1 beta 1 (10 ng/mL) is neutralized (green line) by increasing concentrations of Human ErbB3/Her3 Monoclonal Antibody (Catalog # MAB3481). The ND50 is typically 0.0075-0.03 µg/mL.
(2 Reviews)
(10 Publications)
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(9 Reviews)
(42 Publications)
Species: Hu
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(470 Publications)
Species: Hu
Neuregulin-3/NRG3
Antibody
AF753
Neuregulin‑3/NRG3 was detected in perfusion fixed frozen sections of mouse brain (hippocampus) using Goat Anti-Mouse Neuregulin‑3/NRG3 EGF-like Domain Antigen Affinity-purified Polyclonal Antibody (Catalog # AF753) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cell bodies and neuronal processes. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Mu
Applications: WB, IHC
Epiregulin
Antibody [Unconjugate
AF1195
Epiregulin was detected in immersion fixed paraffin-embedded sections of human skin using Goat Anti-Human Epiregulin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1195) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to keratinocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Epiregulin protein was serially diluted 2-fold and captured by Rat Anti-Human Epiregulin Monoclonal Antibody (Catalog # MAB14252) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human Epiregulin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1195) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Epiregulin (Catalog # 1195-EP) stimulates proliferation in the Balb/3T3 mouse embryonic fibroblast cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Epiregulin (5  ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Epiregulin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1195). The ND50 is typically 0.3-1.5 µg/mL.
(6 Publications)
Species: Hu
Applications: WB, ELISA, IHC, Neut
Amphiregulin [HRP]
DAR00
(6 Reviews)
(9 Publications)
Species: Hu
Betacellulin/BTC
Antibody [Unconjugate ...
AF-261-NA
Betacellulin/BTC was detected in immersion fixed paraffin-embedded sections of human pancreas using Goat Anti-Human Betacellulin/BTC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-261-NA) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to islets. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Betacellulin/BTC was detected in immersion fixed paraffin-embedded sections of human lung cancer tissue using Goat Anti-Human Betacellulin/BTC Antigen Affinity-purified Polyclonal Antibody (Catalog #AF-261-NA) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Betacellulin/BTC (Catalog #261‑CE) stimulates proliferation in the Balb/3T3 mouse embryonic fibroblast cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Betacellulin/BTC (1 ng/mL) is neutralized (green line) by increasing concen­trations of Goat Anti-Human Betacellulin/BTC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-261-NA). The ND50 is typically 0.04‑0.08 µg/mL.
(5 Publications)
Species: Hu
Applications: WB, IHC, Neut
NRG4 Antibody
NBP2-93954
Immunohistochemistry-Paraffin: NRG4 Antibody [NBP2-93954] - Paraffin-embedded rat brain using NRG4.
Immunohistochemistry-Paraffin: NRG4 Antibody [NBP2-93954] - Paraffin-embedded human colon using NRG4.
Immunohistochemistry-Paraffin: NRG4 Antibody [NBP2-93954] - Paraffin-embedded human stomach using NRG4.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
GDF-15 [HRP]
DGD150
(3 Reviews)
(41 Publications)
Species: Hu
HB-EGF
259-HE
HB-EGF
(1 Review)
(52 Publications)
Species: Hu
Epigen Antibody
[Unconjugated]
AF1127
Epigen Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: WB, IHC
Myocilin Antibody
(4F8)
H00004653-M01
Western Blot: Myocilin Antibody (4F8) [H00004653-M01] - Analysis of MYOC expression in transfected 293T cell line by MYOC monoclonal antibody (M01), clone 4F8.Lane 1: MYOC transfected lysate(57 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: Myocilin Antibody (4F8) [H00004653-M01] - Analysis of monoclonal antibody to MYOC on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: Myocilin Antibody (4F8) [H00004653-M01] - Analysis of MYOC over-expressed 293 cell line, cotransfected with MYOC Validated Chimera RNAi ( Cat # H00004653-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYOC monoclonal antibody (M01), clone 4F8 (Cat # H00004653-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP, RNAi
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
SOS1 Antibody
(SOS-01)
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: WB, ICC/IF
RASGRF1 Antibody
NBP2-95233
Western Blot: RASGRF1 Antibody [NBP2-95233] - Analysis of extracts of mouse brain, using RASGRF1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure tim
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP2-95233] - Analysis of U2OS cells using RASGRF1. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP2-95233] - Paraffin-embedded human stomach using RASGRF1.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MUC1 Antibody (SM3)
NB120-22711
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MUC1 [SM3] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MUC-1 Antibody (SM3) [NB120-22711] - IHC analysis of formalin fixed paraffin embedded tissue section of human breast cancer xenograft using MUC-1 antibody clone SM3 at 1:10 dilution. The xenograft section depicted a very specific and intense signal in the periphery of the cancer cells. The necrotic cells also developed a strong immune-positivity while the tumor stroma as well as the nuclei of cells were negative for immunostaining.
Immunocytochemistry/Immunofluorescence: MUC-1 Antibody (SM3) [NB120-22711] - MUC-1 antibody was tested in MCF7 cells at 10 ug/ml using a Dylight 488 conjugated secondary antibody (Green). Actin (Red) and DNA (Blue) were counterstained using Phalloidin 568 and DAPI.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Neuregulin-2
Recombinant Protein A ...
NBP1-87971PEP
Neuregulin-2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Neuregulin-2 Protein (NBP1-87971PEP) (0)

There are no publications for Neuregulin-2 Protein (NBP1-87971PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuregulin-2 Protein (NBP1-87971PEP) (0)

There are no reviews for Neuregulin-2 Protein (NBP1-87971PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neuregulin-2 Protein (NBP1-87971PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional Neuregulin-2 Products

Bioinformatics Tool for Neuregulin-2 Protein (NBP1-87971PEP)

Discover related pathways, diseases and genes to Neuregulin-2 Protein (NBP1-87971PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuregulin-2 Protein (NBP1-87971PEP)

Discover more about diseases related to Neuregulin-2 Protein (NBP1-87971PEP).
 

Pathways for Neuregulin-2 Protein (NBP1-87971PEP)

View related products by pathway.

PTMs for Neuregulin-2 Protein (NBP1-87971PEP)

Learn more about PTMs related to Neuregulin-2 Protein (NBP1-87971PEP).
 

Research Areas for Neuregulin-2 Protein (NBP1-87971PEP)

Find related products by research area.

Blogs on Neuregulin-2

There are no specific blogs for Neuregulin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
EGF [Unconjugated]
236-EG-200
HB-EGF
259-HE-050

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neuregulin-2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NRG2