Neuregulin-1/NRG1 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNATSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLC |
| Predicted Species |
Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NRG1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Neuregulin-1/NRG1 Antibody
Background
Neuregulin 1 (NRG1, isoform HRG-beta2) belongs to the neuregulin/heregulin cytokine family consisting of variants of the four genes NRG1, NRG2, NRG3 and NRG4. More than 15 transmembrane and secreted protein isoforms exist for NRG1, they are generated by alternative promoter usage and mRNA splicing. The different isoforms all contain immunoglobulin (Ig) and epidermal growth factor-like (EGF-like) domains. The EGF-like domain interacts with ErbB3 and ErbB4 tyrosine kinase receptors, resulting in tyrosine phosphorylation and NRG1 signaling. NRG proteins show distinct spatial and temporal expression patterns. These proteins are important for the development of the nervous system and the heart and in the regulation of neurotransmission.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Rt
Applications: IHC
Publications for Neuregulin-1/NRG1 Antibody (NBP1-81834) (0)
There are no publications for Neuregulin-1/NRG1 Antibody (NBP1-81834).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neuregulin-1/NRG1 Antibody (NBP1-81834) (0)
There are no reviews for Neuregulin-1/NRG1 Antibody (NBP1-81834).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Neuregulin-1/NRG1 Antibody (NBP1-81834) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neuregulin-1/NRG1 Products
Research Areas for Neuregulin-1/NRG1 Antibody (NBP1-81834)
Find related products by research area.
|
Blogs on Neuregulin-1/NRG1