Netrin-4 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to Netrin-4 The peptide sequence was selected from the C terminal of Netrin-4. Peptide sequence FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF. |
| Predicted Species |
Rat (93%), Guinea Pig (93%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NTN4 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against Netrin-4 and was validated on Western blot. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Netrin-4 Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Bind
Species: Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: Block, IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: IHC
Species: Hu
Applications: BA
Species: Rt
Applications: Block, ICC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Publications for Netrin-4 Antibody (NBP1-70757) (0)
There are no publications for Netrin-4 Antibody (NBP1-70757).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Netrin-4 Antibody (NBP1-70757) (0)
There are no reviews for Netrin-4 Antibody (NBP1-70757).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Netrin-4 Antibody (NBP1-70757) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Netrin-4 Products
Blogs on Netrin-4