Netrin-4 Antibody

Images

 
Western Blot: Netrin-4 Antibody [NBP1-70757] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Netrin-4 Antibody Summary

Immunogen
Synthetic peptides corresponding to Netrin-4 The peptide sequence was selected from the C terminal of Netrin-4. Peptide sequence FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NTN4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Netrin-4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Netrin-4 Antibody

  • beta-Netrin
  • hepar-derived netrin-like protein
  • netrin 4
  • Netrin4
  • Netrin-4
  • NTN4
  • PRO3091

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1006
Species: Rt
Applications: WB, IHC
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1005
Species: Hu
Applications: WB, IHC
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
AF1405
Species: Rt
Applications: WB, Block, ICC
AF1334
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF2830
Species: Hu
Applications: WB
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-70757
Species: Hu
Applications: WB

Publications for Netrin-4 Antibody (NBP1-70757) (0)

There are no publications for Netrin-4 Antibody (NBP1-70757).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Netrin-4 Antibody (NBP1-70757) (0)

There are no reviews for Netrin-4 Antibody (NBP1-70757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Netrin-4 Antibody (NBP1-70757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Netrin-4 Products

Bioinformatics Tool for Netrin-4 Antibody (NBP1-70757)

Discover related pathways, diseases and genes to Netrin-4 Antibody (NBP1-70757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Netrin-4 Antibody (NBP1-70757)

Discover more about diseases related to Netrin-4 Antibody (NBP1-70757).
 

Pathways for Netrin-4 Antibody (NBP1-70757)

View related products by pathway.

PTMs for Netrin-4 Antibody (NBP1-70757)

Learn more about PTMs related to Netrin-4 Antibody (NBP1-70757).

Blogs on Netrin-4

There are no specific blogs for Netrin-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Netrin-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTN4
Entrez