NEK6 Antibody (1V1X8) Summary
| Description |
Novus Biologicals Rabbit NEK6 Antibody (1V1X8) (NBP3-16215) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NEK6 (Q9HC98). ETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
NEK6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NEK6 Antibody (1V1X8)
Background
NEK6 encodes a NEK type protein kinase, which contains a C-terminal NIMA-like catalytic domain. The protein is believed to regulate chromatin condensation in mammalian cells via phosphorylation of histones H1 and H3, and it has been shown to phosphorylate ribosomal S6 protein kinase (S6K1) and serum and glucocorticoid induced protein kinase (SGK1), which regulate diverse cellular processes. The protein also has been shown to bind NEK9, another NIMA-related kinase which regulates chromosome alignment and segregation. At least three mRNA transcripts have been identified, 1.6-, 2.6-, and 9.5-kb. The NEK6 gene is localized to 9q33-34, a region at which the loss of heterozygosity is associated with transitional cell carcinomas. NEK6 expression has been documented in many normal human tissues, including blood, brain, heart, liver, lung, skeletal muscle, spleen and testis. ESTs have been isolated from numerous tissue libraries, especially normal cervix and amnion and cancerous bone marrow.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IP, WB (-)
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Publications for NEK6 Antibody (NBP3-16215) (0)
There are no publications for NEK6 Antibody (NBP3-16215).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NEK6 Antibody (NBP3-16215) (0)
There are no reviews for NEK6 Antibody (NBP3-16215).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NEK6 Antibody (NBP3-16215) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NEK6 Products
Research Areas for NEK6 Antibody (NBP3-16215)
Find related products by research area.
|
Blogs on NEK6