NEK6 Antibody (1V1X8)

Western Blot: NEK6 Antibody (1V1X8) [NBP3-16215] - Western blot analysis of extracts of various cell lines, using NEK6 Rabbit mAb (NBP3-16215) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.

Immunohistochemistry-Paraffin: NEK6 Antibody (1V1X8) [NBP3-16215] - Immunohistochemistry of paraffin-embedded rat kidney using NEK6 Rabbit mAb (NBP3-16215) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Western Blot: NEK6 Antibody (1V1X8) [NBP3-16215] - Western blot analysis of extracts of various cell lines, using NEK6 Rabbit mAb (NBP3-16215) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 1V1X8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

NEK6 Antibody (1V1X8) Summary

• Description: Novus Biologicals Rabbit NEK6 Antibody (1V1X8) (NBP3-16215) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NEK6 (Q9HC98). ETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NEK6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NEK6 Antibody (1V1X8)

• EC 2.7.11.1
• Never in mitosis A-related kinase 6
• NIMA (never in mitosis gene a)-related kinase 6
• NimA-related protein kinase 6
• Protein kinase SID6-1512
• putative serine-threonine protein kinase
• serine/threonine-protein kinase Nek6
• SID6-1512

Background

NEK6 encodes a NEK type protein kinase, which contains a C-terminal NIMA-like catalytic domain. The protein is believed to regulate chromatin condensation in mammalian cells via phosphorylation of histones H1 and H3, and it has been shown to phosphorylate ribosomal S6 protein kinase (S6K1) and serum and glucocorticoid induced protein kinase (SGK1), which regulate diverse cellular processes. The protein also has been shown to bind NEK9, another NIMA-related kinase which regulates chromosome alignment and segregation. At least three mRNA transcripts have been identified, 1.6-, 2.6-, and 9.5-kb. The NEK6 gene is localized to 9q33-34, a region at which the loss of heterozygosity is associated with transitional cell carcinomas. NEK6 expression has been documented in many normal human tissues, including blood, brain, heart, liver, lung, skeletal muscle, spleen and testis. ESTs have been isolated from numerous tissue libraries, especially normal cervix and amnion and cancerous bone marrow.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEK6