NEK2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NEK2 Antibody [NBP2-57424] - Staining of human cell line RH-30 shows localization to nucleoplasm & centrosome.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NEK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NEK2 Antibody - BSA Free (NBP2-57424) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NEK2 Recombinant Protein Antigen (NBP2-57424PEP)

Reactivity Notes

Mouse 87%, Rat 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NEK2 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• HSPK 21
• HsPK21
• NEK2
• NEK2AHsPK21
• Never in mitosis A-related kinase 2
• NIMA (never in mitosis gene a)-related kinase 2
• NimA-like protein kinase 1
• NimA-related protein kinase 2
• NLK1
• NLK1serine/threonine-protein kinase Nek2

Background

Protein kinase that is involved in mitotic regulation. May have a role at the G2-M transition. May also play a role in meiosis. Isoform 1 but not isoform 2 appears to play a role in centrosome splitting. Isoform 1 phosphorylates and activates NEK11 in G1/S-arrested cells. Isoform 2, which is not present in the nucleolus, does not

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEK2