We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NEDD9/CASL/HEF1 Antibody - BSA Free

Images

 
Western Blot: NEDD9/CASL/HEF1 Antibody [NBP2-55071] - Analysis in human cell line RT-4.
Staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NEDD9/CASL/HEF1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEDD9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEDD9/CASL/HEF1 Recombinant Protein Antigen (NBP2-55071PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NEDD9/CASL/HEF1 Antibody - BSA Free

  • Cas scaffolding protein family member 2
  • CAS2
  • CASL
  • CAS-LCASS2cas-like docking
  • CASLdJ49G10.2
  • CRK-associated substrate-related protein
  • dJ49G10.2 (Enhancer of Filamentation 1 (HEF1))
  • dJ761I2.1 (enhancer of filamentation (HEF1))
  • dJ761I2.1
  • enhancer of filamentation 1
  • HEF1
  • HEF1Crk-associated substrate related
  • NEDD9
  • NEDD-9
  • Neural precursor cell expressed developmentally down-regulated protein 9
  • neural precursor cell expressed, developmentally down-regulated 9
  • p105
  • Renal carcinoma antigen NY-REN-12

Background

HEF1, also known as Enhancer of filamentation 1, CRKassociated substrate-related protein, CAS-L, CasL, p105 and Neural precursor cell expressed developmentally down-regulated 9 is the product of the NEDD9 (CASGL) gene. HEF1 functions as a docking protein that plays a central coordinating role for tyrosine-kinase-based signaling related to cell adhesion. HEF1 may also function in transmitting growth control signals between focal adhesions at the cell periphery and the mitotic spindle in response to adhesion or growth factor signals initiating cell proliferation. HEF1 may also play an important role in integrin beta-1 or B cell antigen receptor (BCR) mediated signaling in B- and T-cells. Integrin beta-1 stimulation leads to recruitment of various proteins including CRK, NCK and SHPTP2 to the tyrosine phosphorylated form. HEF1 forms a homodimer and can heterodimerize with HLH proteins ID2, E12, E47 and also with p130cas. HEF1 also forms complexes in vivo with related adhesion focal tyrosine kinase (RAFTK), adapter protein CRKL and LYN kinase and also interacts with MICAL and TXNL4/DIM1. This protein localizes to both the cell nucleus and the cell periphery and is differently localized in fibroblasts and epithelial cells. In fibroblasts, it is predominantly nuclear and in some cells is present in the Golgi apparatus. In epithelial cells, it is localized predominantly in the cell periphery with particular concentration in lamellipodia, but it is also found in the nucleus. HEF1 is widely expressed although higher levels are detected in kidney, lung, and placental tissue. HEF1 is also detected in T-cells, B-cells and diverse cell lines. HEF1 is activated upon induction of cell growth. Cell cycle-regulated processing produces four isoforms: p115, p105, p65, and p55. Isoform p115 arises from p105 phosphorylation and appears later in the cell cycle. Isoform p55 arises from p105 as a result of cleavage at a caspase cleavage-related site and it appears specifically at mitosis. The p65 isoform is poorly detected. Isoforms p105 and p115 are predominantly cytoplasmic and associate with focal adhesions while p55 associates with the mitotic spindle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-12897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-31993
Species: Hu
Applications: IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-38206
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82455
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-49695
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NBP2-24459
Species: Ca, Ch, Hu, Mu, Pm, Rb, Rt, RM, Xp, Ze
Applications: ICC/IF, WB
NBP1-84621
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-87462
Species: Hu
Applications: IHC,  IHC-P
H00057091-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-55071
Species: Hu
Applications: WB, ICC/IF

Publications for NEDD9/CASL/HEF1 Antibody (NBP2-55071) (0)

There are no publications for NEDD9/CASL/HEF1 Antibody (NBP2-55071).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD9/CASL/HEF1 Antibody (NBP2-55071) (0)

There are no reviews for NEDD9/CASL/HEF1 Antibody (NBP2-55071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEDD9/CASL/HEF1 Antibody (NBP2-55071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDD9/CASL/HEF1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NEDD9