Home » NEDD4L » NEDD4L Antibodies » NEDD4L Antibody

NEDD4L Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: NEDD4L Antibody [NBP2-56344] - Staining of human cell line Hep G2 shows localization to focal adhesion sites.
Immunocytochemistry/ Immunofluorescence: NEDD4L Antibody [NBP2-56344] - Staining of human cell line Hep G2 shows localization to focal adhesion sites.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NEDD4L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
Specificity
Specificity of human NEDD4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEDD4L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEDD4L Recombinant Protein Antigen (NBP2-56344PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NEDD4L Antibody

  • E3 ubiquitin-protein ligase NEDD4-like
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ33870
  • hNedd4-2
  • KIAA0439ubiquitin-protein ligase NEDD4-like
  • NEDD4.2
  • NEDD4-2
  • NEDL3
  • neural precursor cell expressed, developmentally down-regulated 4-like
  • neural precursor cell expressed, developmentally down-regulated gene 4-like
  • RSP5ubiquitin-protein ligase Rsp5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SGK1 Antibody
NBP2-19010
Western Blot: SGK1 Antibody [NBP2-19010] - analysis of SGK1 in human lung lysate in the 1) absence and 2) presence of immunizing peptide, 3) human kidney lysate probed with 1 ug/ml of SGK1 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: SGK1 Antibody [NBP2-19010] - analysis of SGK1 in human lung probed with SGK1 antibody at 5 ug/ml.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
NEDD4 Antibody
NBP2-27197
Western Blot: NEDD4 Antibody [NBP2-27197] - analysis of NEDD4 in mouse embryonic brain tissue lysate in the 1) absence and 2) presence of immunizing peptide using NEDD4 antibody at 5 ug/ml. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
ILT6/CD85e/LILRA3
Antibody [Unconjugate ...
AF2574
Human peripheral blood monoctyes were stained with Mouse Anti-Human CD14 APC‑conjugated Monoclonal Antibody (Catalog # FAB3832A) and either (A) Goat Anti-Human LILRA3/CD85e Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2574) or (B) Normal Goat IgG Control(Catalog # AB-108-C) followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Species: Hu
Applications: CyTOF-ready, ICFlow
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Paraffin-embedded Gastric CA.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
UBE2K/E2-25K
Antibody (701316)
MAB6609
Western blot shows lysates of human brain (cortex) tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human UBE2K/E2‑25K Monoclonal Antibody (Catalog # MAB6609) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for UBE2K/E2‑25K at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
UBE2K/E2‑25K was detected in immersion fixed paraffin-embedded sections of human Alzheimer's brain using Mouse Anti-Human UBE2K/E2‑25K Monoclonal Antibody (Catalog # MAB6609) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu, Mu
Applications: WB, IHC
UBR5/EDD Antibody
NB100-1591
Western Blot: UBR5/EDD Antibody [NB100-1591] - Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-EDD1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: UBR5/EDD Antibody [NB100-1591] - FFPE section of mouse teratoma. Antibody: Affinity purified rabbit anti-EDD1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: UBR5/EDD Antibody [NB100-1591] - FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-EDD1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(6 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
ZNF645 Antibody
NBP2-21037
Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
MUL1 Antibody
NBP2-31363
Western Blot: MUL1 Antibody [NBP2-31363] - Western blot analysis of K562 (A), Rt4 (B), and SH-SY5Y (C) cell lysate using MUL1 antibody at a concentration of 2 ug/ml.
Immunocytochemistry/Immunofluorescence: MUL1 Antibody [NBP2-31363] - MUL1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). An antibody concentration of 0.1 ug/ml was used.
Western Blot: MUL1 Antibody [NBP2-31363] - WB analysis of MUL1 protein in lysate of human liver and partial recombinant MUL1 protein by using the primary antibody concentration of 2ug/ml and 0.5 ug/ml respectively.
Species: Hu
Applications: WB, ICC/IF
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.
Species: Hu
Applications: IHC, IHC-P
SGK3 Antibody
NLS7240
Immunohistochemistry-Paraffin: SGK3 Antibody [NLS7240] - Anti-SGK3 antibody IHC of human Lung, Non-Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: SGK3 Antibody [NLS7240] - Analysis of anti-SGK3 antibody with human islet of langerhans at 1 ug/ml.
Immunohistochemistry-Paraffin: SGK3 Antibody [NLS7240] - Anti-SGK3 antibody IHC of human Ovary, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
(1 Publication)
Species: Hu, Mu, Rt, Bt, Ca, Ha
Applications: IHC-P
E6AP/UBE3A Antibody
NB500-240
Western Blot: E6AP/UBE3A Antibody [NB500-240] - UBE3A Antibody [NB500-240] - Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-E6AP antibody used for WB at 0.4 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate. E6AP was also immunoprecipitated by rabbit anti-E6AP antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 3 minutes (A and B).
(8 Publications)
Species: Hu, Mu
Applications: WB, IP
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
14-3-3 Antibody
NBP2-27202
Western Blot: 14-3-3 Antibody [NBP2-27202] - analysis of 14-3-3 using 14-3-3 antibody. Human Brain tissue lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain, and 4) rat brain lysate probed with 2 ug/ml of 14-3-3 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Simple Western: 14-3-3 Antibody [NBP2-27202] - Simple Western lane view shows a specific band for 14-3-3 Gamma in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Review)
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining in human kidney and pancreas tissues using anti-DBT antibody. Corresponding DBT RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NEDD4L Antibody
NBP2-56344
NEDD4L Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for NEDD4L Antibody (NBP2-56344) (0)

There are no publications for NEDD4L Antibody (NBP2-56344).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD4L Antibody (NBP2-56344) (0)

There are no reviews for NEDD4L Antibody (NBP2-56344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NEDD4L Antibody (NBP2-56344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NEDD4L Antibody (NBP2-56344)

Discover related pathways, diseases and genes to NEDD4L Antibody (NBP2-56344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDD4L Antibody (NBP2-56344)

Discover more about diseases related to NEDD4L Antibody (NBP2-56344).
 

Pathways for NEDD4L Antibody (NBP2-56344)

View related products by pathway.

PTMs for NEDD4L Antibody (NBP2-56344)

Learn more about PTMs related to NEDD4L Antibody (NBP2-56344).

Blogs on NEDD4L

There are no specific blogs for NEDD4L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDD4L Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NEDD4L