NEDD4L Antibody


Immunocytochemistry/ Immunofluorescence: NEDD4L Antibody [NBP2-56344] - Staining of human cell line Hep G2 shows localization to focal adhesion sites.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

NEDD4L Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
Specificity of human NEDD4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEDD4L Recombinant Protein Antigen (NBP2-56344PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NEDD4L Antibody

  • E3 ubiquitin-protein ligase NEDD4-like
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ33870
  • hNedd4-2
  • KIAA0439ubiquitin-protein ligase NEDD4-like
  • NEDD4.2
  • NEDD4-2
  • NEDL3
  • neural precursor cell expressed, developmentally down-regulated 4-like
  • neural precursor cell expressed, developmentally down-regulated gene 4-like
  • RSP5ubiquitin-protein ligase Rsp5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bt, Ca, Ha
Applications: IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for NEDD4L Antibody (NBP2-56344) (0)

There are no publications for NEDD4L Antibody (NBP2-56344).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD4L Antibody (NBP2-56344) (0)

There are no reviews for NEDD4L Antibody (NBP2-56344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NEDD4L Antibody (NBP2-56344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for NEDD4L Antibody (NBP2-56344)

Discover related pathways, diseases and genes to NEDD4L Antibody (NBP2-56344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDD4L Antibody (NBP2-56344)

Discover more about diseases related to NEDD4L Antibody (NBP2-56344).

Pathways for NEDD4L Antibody (NBP2-56344)

View related products by pathway.

PTMs for NEDD4L Antibody (NBP2-56344)

Learn more about PTMs related to NEDD4L Antibody (NBP2-56344).

Blogs on NEDD4L

There are no specific blogs for NEDD4L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NEDD4L Antibody and receive a gift card or discount.


Gene Symbol NEDD4L