Home » NEDD4L » NEDD4L Antibodies » NEDD4L Antibody

NEDD4L Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: NEDD4L Antibody [NBP2-56344] - Staining of human cell line Hep G2 shows localization to focal adhesion sites.
Immunocytochemistry/ Immunofluorescence: NEDD4L Antibody [NBP2-56344] - Staining of human cell line Hep G2 shows localization to focal adhesion sites.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NEDD4L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP
Specificity
Specificity of human NEDD4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEDD4L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEDD4L Recombinant Protein Antigen (NBP2-56344PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NEDD4L Antibody

  • E3 ubiquitin-protein ligase NEDD4-like
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ33870
  • hNedd4-2
  • KIAA0439ubiquitin-protein ligase NEDD4-like
  • NEDD4.2
  • NEDD4-2
  • NEDL3
  • neural precursor cell expressed, developmentally down-regulated 4-like
  • neural precursor cell expressed, developmentally down-regulated gene 4-like
  • RSP5ubiquitin-protein ligase Rsp5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SGK1 Antibody
(SC05-71)
NBP2-67561
Western Blot: SGK1 Antibody (SC05-71) [NBP2-67561] - Analysis of SGK1 on human kidney lysates using anti-SGK1 antibody at 1/1,000 dilution.
Immunohistochemistry-Paraffin: SGK1 Antibody (SC05-71) [NBP2-67561] - Analysis of paraffin-embedded mouse liver tissue using anti-SGK1 antibody. Counter stained with hematoxylin.
Flow Cytometry: SGK1 Antibody (SC05-71) [NBP2-67561] - Analysis of 293 cells with SGK1 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NEDD4 Antibody
NBP2-27201
Western Blot: NEDD4 Antibody [NBP2-27201] - Analysis of NEDD4 in mouse embryo brain tissue lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27201. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
(3 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot: ILT6/CD85e/LILRA3 Antibody (2E9) [H00011026-M01] - Analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.Lane 1: LILRA3 transfected lysate(50.485 KDa).Lane 2: Non-transfected lysate.
(5 Publications)
Species: Hu
Applications: WB, ELISA
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Human gastric cancer, using DLD antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
UBE2K/E2-25K
Antibody (701316)
MAB6609
Western blot shows lysates of human brain (cortex) tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human UBE2K/E2‑25K Monoclonal Antibody (Catalog # MAB6609) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for UBE2K/E2‑25K at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
UBE2K/E2‑25K was detected in immersion fixed paraffin-embedded sections of human Alzheimer's brain using Mouse Anti-Human UBE2K/E2‑25K Monoclonal Antibody (Catalog # MAB6609) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu, Mu
Applications: WB, IHC
UBR5/EDD Antibody
NB100-1591
Western Blot: UBR5/EDD Antibody [NB100-1591] - Samples: Whole cell lysate (50 ug) from HEK293T, Jurkat, and LNCaP cells prepared using NETN lysis buffer. Antibody: Affinity purified Rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: UBR5/EDD Antibody [NB100-1591] - Sample: FFPE section of human lung carcinoma. Antibody: Affinity purified rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used at a dilution of 1:1,000 (1 ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: UBR5/EDD Antibody [NB100-1591] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit UBR5/EDD Antibody (NB100-1591, lot 6) used at a dilution of 1:1000 (1 ug/ml). Detection: DAB
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
ZNF645 Antibody
NBP2-21037
Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
MUL1 Antibody
(5H6.2D5)
NBP2-31361
Western Blot: MUL1 Antibody (5H6.2D5) [NBP2-31361] - WB detection of partial recombinant protein MUL1 by using MUL1 antibody (clone 5H6.2D5) at a concentration of 0.01 ug/ml.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a transverse section of normal skeletal muscle from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). The myocytes and blood capillaries depicted strong staining whereas the nuclei were found negative for MUL1.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal prostate from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). Strong cytoplasmic staining was observed in the epithelial columnar and basal cells of prostate glands.
Species: Hu
Applications: WB, IHC, IHC-P
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.
Species: Hu
Applications: IHC, IHC-P
SGK3 Antibody
NB100-59014
Immunocytochemistry: SGK3 Antibody [NB100-59014] - Immunohistochemical analysis of brain tissue, senile plaques caused by Alzheimer's.
Immunohistochemistry-Paraffin: SGK3 Antibody [NB100-59014] - Anti-SGK3 antibody IHC of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: SGK3 Antibody [NB100-59014] - Anti-SGK3 antibody IHC of human Pancreas, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu
Applications: ELISA, IHC, IHC-P, ICC
E6AP/UBE3A
Antibody (2F6)
H00007337-M01
Western Blot: E6AP/UBE3A Antibody (2F6) [H00007337-M01] - UBE3A monoclonal antibody (M01), clone 2F6. Analysis of UBE3A expression in PC-12.
Immunocytochemistry/Immunofluorescence: E6AP/UBE3A Antibody (2F6) [H00007337-M01] - Analysis of monoclonal antibody to UBE3A on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: E6AP/UBE3A Antibody (2F6) [H00007337-M01] - Analysis of monoclonal antibody to UBE3A on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
(3 Publications)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
14-3-3 Antibody
NBP2-27202
Western Blot: 14-3-3 Antibody [NBP2-27202] - analysis of 14-3-3 using 14-3-3 antibody. Human Brain tissue lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain, and 4) rat brain lysate probed with 2 ug/ml of 14-3-3 antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: 14-3-3 Antibody [NBP2-27202] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-14-3-3 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Simple Western: 14-3-3 Antibody [NBP2-27202] - Simple Western lane view shows a specific band for 14-3-3 Gamma in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Review)
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NEDD4L Antibody
NBP2-56344
NEDD4L Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for NEDD4L Antibody (NBP2-56344) (0)

There are no publications for NEDD4L Antibody (NBP2-56344).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD4L Antibody (NBP2-56344) (0)

There are no reviews for NEDD4L Antibody (NBP2-56344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NEDD4L Antibody (NBP2-56344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NEDD4L Products

Bioinformatics Tool for NEDD4L Antibody (NBP2-56344)

Discover related pathways, diseases and genes to NEDD4L Antibody (NBP2-56344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDD4L Antibody (NBP2-56344)

Discover more about diseases related to NEDD4L Antibody (NBP2-56344).
 

Pathways for NEDD4L Antibody (NBP2-56344)

View related products by pathway.

PTMs for NEDD4L Antibody (NBP2-56344)

Learn more about PTMs related to NEDD4L Antibody (NBP2-56344).

Blogs on NEDD4L

There are no specific blogs for NEDD4L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDD4L Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NEDD4L