Nectin-4/PVRL4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Nectin-4/PVRL4 Antibody [NBP1-82829] - Staining in human skin and skeletal muscle tissues.. Corresponding NECTIN4 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: Nectin-4/PVRL4 Antibody [NBP1-82829] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Nectin-4/PVRL4 Antibody [NBP1-82829] - Staining of human urinary bladder shows moderate membranous positivity in urothelial cells.

Immunohistochemistry-Paraffin: Nectin-4/PVRL4 Antibody [NBP1-82829] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Nectin-4/PVRL4 Antibody [NBP1-82829] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Nectin-4/PVRL4 Antibody [NBP1-82829] - Staining of human skin shows moderate membranous positivity in keratinocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nectin-4/PVRL4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NECTIN4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Nectin-4/PVRL4 Protein (NBP1-82829PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nectin-4/PVRL4 Antibody - BSA Free

• EDSS1
• Ig superfamily receptor LNIR
• LNIR
• LNIRnectin 4
• Nectin4
• Nectin-4
• poliovirus receptor-related 4
• poliovirus receptor-related protein 4
• PRR4
• PRR4DKFZp686K05193
• PVRL4

Background

PVRL4, also known as Poliovirus receptor-related protein 4, is a 510 amino acid protein that is 55 kDa, predominantly expressed in placenta and breast carcinoma, is a single-pass type I membrane protein involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with PVRL2/nectin-1, and oes not act as receptor for alpha-herpesvirus entry into cells. Disease research is being performed in relation to this protein and ectodermal dysplasia, syndactyly, ectodermal dysplasia-syndactyly syndrome 1, measles, ovarian cancer, breast carcinoma, lung cancer, and carcinoma. The PVRL4 protein has shown an interaction with PVRL1, MLLT4, PICK1, TIGIT, PARD3, PVRL3, and PVRL2 in Adherens junctions interactions, Nectin/Necl trans heterodimerization, Cell junction organization, Cell-Cell communication, Cell-cell junction organization, Sertoli-Sertoli Cell Junction Dynamics, and Epithelial Adherens Junctions pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NECTIN4