Nectin-4/PVRL4 Antibody

Images

 
Western Blot: Nectin-4/PVRL4 Antibody [NBP1-82829] - Analysis in control (vector only transfected HEK293T lysate) and PVRL4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: Nectin-4/PVRL4 Antibody [NBP1-82829] - Staining of human cell line U-2 OS shows localization to plasma membrane.
Immunohistochemistry-Paraffin: Nectin-4/PVRL4 Antibody [NBP1-82829] - Staining of human esophagus shows moderate membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nectin-4/PVRL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PVRL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nectin-4/PVRL4 Protein (NBP1-82829PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nectin-4/PVRL4 Antibody

  • EDSS1
  • Ig superfamily receptor LNIR
  • LNIR
  • LNIRnectin 4
  • Nectin4
  • Nectin-4
  • poliovirus receptor-related 4
  • poliovirus receptor-related protein 4
  • PRR4
  • PRR4DKFZp686K05193
  • PVRL4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP2-46231
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
AF4478
Species: Hu
Applications: WB, IHC
AF3064
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-07799
Species: Hu
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82829
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Nectin-4/PVRL4 Antibody (NBP1-82829) (0)

There are no publications for Nectin-4/PVRL4 Antibody (NBP1-82829).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nectin-4/PVRL4 Antibody (NBP1-82829) (0)

There are no reviews for Nectin-4/PVRL4 Antibody (NBP1-82829). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nectin-4/PVRL4 Antibody (NBP1-82829) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nectin-4/PVRL4 Products

Bioinformatics Tool for Nectin-4/PVRL4 Antibody (NBP1-82829)

Discover related pathways, diseases and genes to Nectin-4/PVRL4 Antibody (NBP1-82829). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nectin-4/PVRL4 Antibody (NBP1-82829)

Discover more about diseases related to Nectin-4/PVRL4 Antibody (NBP1-82829).
 

Pathways for Nectin-4/PVRL4 Antibody (NBP1-82829)

View related products by pathway.

PTMs for Nectin-4/PVRL4 Antibody (NBP1-82829)

Learn more about PTMs related to Nectin-4/PVRL4 Antibody (NBP1-82829).

Blogs on Nectin-4/PVRL4

There are no specific blogs for Nectin-4/PVRL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nectin-4/PVRL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PVRL4
Entrez