Nectin-4/PVRL4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Nectin-4/PVRL4 Antibody - BSA Free (NBP1-82829) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL |
| Predicted Species |
Mouse (90%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NECTIN4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Nectin-4/PVRL4 Antibody - BSA Free
Background
PVRL4, also known as Poliovirus receptor-related protein 4, is a 510 amino acid protein that is 55 kDa, predominantly expressed in placenta and breast carcinoma, is a single-pass type I membrane protein involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with PVRL2/nectin-1, and oes not act as receptor for alpha-herpesvirus entry into cells. Disease research is being performed in relation to this protein and ectodermal dysplasia, syndactyly, ectodermal dysplasia-syndactyly syndrome 1, measles, ovarian cancer, breast carcinoma, lung cancer, and carcinoma. The PVRL4 protein has shown an interaction with PVRL1, MLLT4, PICK1, TIGIT, PARD3, PVRL3, and PVRL2 in Adherens junctions interactions, Nectin/Necl trans heterodimerization, Cell junction organization, Cell-Cell communication, Cell-cell junction organization, Sertoli-Sertoli Cell Junction Dynamics, and Epithelial Adherens Junctions pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Publications for Nectin-4/PVRL4 Antibody (NBP1-82829) (0)
There are no publications for Nectin-4/PVRL4 Antibody (NBP1-82829).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nectin-4/PVRL4 Antibody (NBP1-82829) (0)
There are no reviews for Nectin-4/PVRL4 Antibody (NBP1-82829).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nectin-4/PVRL4 Antibody (NBP1-82829) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nectin-4/PVRL4 Products
Blogs on Nectin-4/PVRL4