NDUFV1 Antibody (4A7)

Images

 
Western Blot: NDUFV1 Antibody (4A7) [H00004723-M01] - NDUFV1 monoclonal antibody (M01), clone 4A7. Analysis of NDUFV1 expression in PC-12.
Western Blot: NDUFV1 Antibody (4A7) [H00004723-M01] - Western Blot analysis of NDUFV1 expression in A-431 ( Cat # L015V1 ).
Western Blot: NDUFV1 Antibody (4A7) [H00004723-M01] - Analysis of NDUFV1 over-expressed 293 cell line, cotransfected with NDUFV1 Validated Chimera RNAi ( Cat # H00004723-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: NDUFV1 Antibody (4A7) [H00004723-M01] - Analysis of NDUFV1 expression in transfected 293T cell line by NDUFV1 monoclonal antibody (M01), clone 4A7.Lane 1: NDUFV1 transfected lysate(50.8 KDa).Lane 2: ...read more
ELISA: NDUFV1 Antibody (4A7) [H00004723-M01] - Detection limit for recombinant GST tagged NDUFV1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, RNAi
Clone
4A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDUFV1 Antibody (4A7) Summary

Immunogen
NDUFV1 (NP_002466 365 a.a. - 464 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
Specificity
NDUFV1 (4A7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDUFV1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Positive Control
A-431 Lysate (NB820-59461)
Publications
Read Publication using H00004723-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFV1 Antibody (4A7)

  • CI-51K
  • CI51KD
  • CI-51kD
  • complex I 51kDa subunit
  • complex I, mitochondrial respiratory chain
  • Complex I-51kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • FLJ59059
  • mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1
  • NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
  • NADH dehydrogenase flavoprotein 1
  • NADH-ubiquinone oxidoreductase 51 kDa subunit
  • UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

Background

The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00374291-P01
Species: Hu
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84475
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP2-47359
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83997
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56930
Species: Hu
Applications: ICC/IF
AF3014
Species: Hu
Applications: WB, IHC, Block
MAB1195
Species: Multi
Applications: WB, Simple Western, ICC
NBP1-82662
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi

Publications for NDUFV1 Antibody (H00004723-M01)(1)

Reviews for NDUFV1 Antibody (H00004723-M01) (0)

There are no reviews for NDUFV1 Antibody (H00004723-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFV1 Antibody (H00004723-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional NDUFV1 Products

Bioinformatics Tool for NDUFV1 Antibody (H00004723-M01)

Discover related pathways, diseases and genes to NDUFV1 Antibody (H00004723-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV1 Antibody (H00004723-M01)

Discover more about diseases related to NDUFV1 Antibody (H00004723-M01).
 

Pathways for NDUFV1 Antibody (H00004723-M01)

View related products by pathway.

PTMs for NDUFV1 Antibody (H00004723-M01)

Learn more about PTMs related to NDUFV1 Antibody (H00004723-M01).

Blogs on NDUFV1

There are no specific blogs for NDUFV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFV1 Antibody (4A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFV1
Entrez
OMIM
Uniprot