NDUFS6 Antibody - BSA Free

Western Blot: NDUFS6 Antibody [NBP1-98576] - Mouse liver, heart and brain mitochondria extract, concentration 2 ug/ml.

Western Blot: NDUFS6 Antibody [NBP1-98576] - Mouse Small Intestine Lysate 1.0ug/ml, Gel Concentration: 10-20%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NDUFS6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Ndufs6 - N-terminal region. Peptide sequence AARGFGVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFS6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 13 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NDUFS6 Antibody - BSA Free

• CI13KDA
• Complex I-13kD-A
• mitochondrial respiratory chain, 13-kD subunit
• NADH dehydrogenase (ubiquinone) Fe-S protein 6 (13kD) (NADH-coenzyme Qreductase)
• NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Qreductase)
• NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
• NADH:ubiquinone oxidoreductase NDUFS6 subunit
• NADH-ubiquinone oxidoreductase 13 kDa-A subunit

Background

Ndufs6 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFS6
• Uniprot:
  • NP_035018(Mouse)