NDUFB9 Antibody


Western Blot: NDUFB9 Antibody [NBP1-88940] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunocytochemistry/ Immunofluorescence: NDUFB9 Antibody [NBP1-88940] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: NDUFB9 Antibody [NBP1-88940] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: NDUFB9 Antibody [NBP1-88940] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NDUFB9 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
Specificity of human, mouse, rat NDUFB9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFB9 Protein (NBP1-88940PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NDUFB9 Antibody

  • B22
  • CI-B22
  • complex I B22 subunit
  • Complex I-B22
  • FLJ22885
  • LYR motif-containing protein 3
  • LYRM3DKFZp566O173
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
  • NADH-ubiquinone oxidoreductase B22 subunit
  • UQOR22NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9 (22kD, B22)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC

Publications for NDUFB9 Antibody (NBP1-88940) (0)

There are no publications for NDUFB9 Antibody (NBP1-88940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB9 Antibody (NBP1-88940) (0)

There are no reviews for NDUFB9 Antibody (NBP1-88940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFB9 Antibody (NBP1-88940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NDUFB9 Products

Bioinformatics Tool for NDUFB9 Antibody (NBP1-88940)

Discover related pathways, diseases and genes to NDUFB9 Antibody (NBP1-88940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB9 Antibody (NBP1-88940)

Discover more about diseases related to NDUFB9 Antibody (NBP1-88940).

Pathways for NDUFB9 Antibody (NBP1-88940)

View related products by pathway.

Blogs on NDUFB9

There are no specific blogs for NDUFB9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFB9 Antibody and receive a gift card or discount.


Gene Symbol NDUFB9