NDUFB9 Antibody - BSA Free

Western Blot: NDUFB9 Antibody [NBP1-88940] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate

Immunocytochemistry/Immunofluorescence: NDUFB9 Antibody [NBP1-88940] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: NDUFB9 Antibody [NBP1-88940] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Western Blot: NDUFB9 Antibody [NBP1-88940] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFB9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFB9 Antibody - BSA Free (NBP1-88940) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NDUFB9 Protein (NBP1-88940PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDUFB9 Antibody - BSA Free

• B22
• CI-B22
• complex I B22 subunit
• Complex I-B22
• FLJ22885
• LYR motif-containing protein 3
• LYRM3DKFZp566O173
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa
• NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
• NADH-ubiquinone oxidoreductase B22 subunit
• UQOR22NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9 (22kD, B22)

Background

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFB9