NDUFB3 Antibody - Azide and BSA Free


Western Blot: NDUFB3 Antibody [NBP2-93366] - Analysis of extracts of various cell lines, using NDUFB3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more
Immunocytochemistry/ Immunofluorescence: NDUFB3 Antibody [NBP2-93366] - Analysis of L929 cells using NDUFB3 . Blue: DAPI for nuclear staining.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NDUFB3 Antibody - Azide and BSA Free Summary

Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human NDUFB3 (NP_002482.1). MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Western Blot 1:500-1:2000
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS (pH 7.3), 50% glycerol
0.01% Thimerosal
Affinity purified

Alternate Names for NDUFB3 Antibody - Azide and BSA Free

  • 3 (12kD, B12)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa


The multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. See NDUFA2 (MIM 602137).[supplied by OMIM]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDUFB3 Antibody (NBP2-93366) (0)

There are no publications for NDUFB3 Antibody (NBP2-93366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB3 Antibody (NBP2-93366) (0)

There are no reviews for NDUFB3 Antibody (NBP2-93366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFB3 Antibody (NBP2-93366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NDUFB3 Products

Research Areas for NDUFB3 Antibody (NBP2-93366)

Find related products by research area.

Blogs on NDUFB3

There are no specific blogs for NDUFB3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFB3 Antibody - Azide and BSA Free and receive a gift card or discount.


Gene Symbol NDUFB3