NDUFAF1 Antibody (4K8Y8) Summary
| Description |
Novus Biologicals Rabbit NDUFAF1 Antibody (4K8Y8) (NBP3-16313) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFAF1 (Q9Y375). MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVVWQFRGKEDLDKWTVTSDKTIGGRSEV |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
NDUFAF1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NDUFAF1 Antibody (4K8Y8)
Background
The NDUFAF1 gene encodes the human homolog of a Neurospora crassa Cia30 protein involved in the assembly of complex I.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
Species: Hu, Mu, Ze
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Publications for NDUFAF1 Antibody (NBP3-16313) (0)
There are no publications for NDUFAF1 Antibody (NBP3-16313).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NDUFAF1 Antibody (NBP3-16313) (0)
There are no reviews for NDUFAF1 Antibody (NBP3-16313).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NDUFAF1 Antibody (NBP3-16313) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NDUFAF1 Products
Research Areas for NDUFAF1 Antibody (NBP3-16313)
Find related products by research area.
|
Blogs on NDUFAF1