NDUFA9 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDUFA9. Source: E. coli Amino Acid Sequence: AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
NDUFA9 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57798. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for NDUFA9 Recombinant Protein Antigen
Background
ATP is generated via oxidative phosphorylation (Oxphos) in the mitochondria of almost all cells. The protein components of Oxphos, 4 respiratory chain complexes (I-IV) and an ATP synthase, are encoded in both the mitochondrial and nuclear genomes. Of the 4 respiratory chain complexes, complex I is the largest at 900 kD and contains at least 41 polypeptide subunits, 7 of which are encoded in the mitochondria, the remaining subunits are encoded in the nucleus. The multisubunit NADH:ubiquinone oxidoreductase is the first enzyme complex. By use of chaotropic agents, complex I can be fragmented into 3 different fractions. The flavoprotein fraction contains the NDUFV1, NDUFV2, and NDUFV3 subunits. The iron-sulfur protein (IP) fraction contains at least 7 subunits, NDUFS1-NDUFS6 and NDUFA5. The remaining subunits are part of the hydrophobic protein (HP) fraction. NDUFA9 is part of the hydrophobic protein fraction of the enzyme complex. However, it is predominantly hydrophilic, and appears to lie mostly outside the lipid bilayer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Publications for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP) (0)
There are no publications for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP) (0)
There are no reviews for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP) (0)
Additional NDUFA9 Products
Research Areas for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP)
Find related products by research area.
|
Blogs on NDUFA9