NDUFA9 Recombinant Protein Antigen

Images

 
There are currently no images for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NDUFA9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDUFA9.

Source: E. coli

Amino Acid Sequence: AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NDUFA9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57798.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NDUFA9 Recombinant Protein Antigen

  • CC6
  • CI39k
  • CI-39k
  • CI-39kD
  • complex I 39kDa subunit
  • Complex I-39kD
  • MGC111043
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase)
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
  • NADH-ubiquinone oxidoreductase 39 kDa subunit
  • NDUFS2L
  • SDR22E1
  • short chain dehydrogenase/reductase family 22E, member 1

Background

ATP is generated via oxidative phosphorylation (Oxphos) in the mitochondria of almost all cells. The protein components of Oxphos, 4 respiratory chain complexes (I-IV) and an ATP synthase, are encoded in both the mitochondrial and nuclear genomes. Of the 4 respiratory chain complexes, complex I is the largest at 900 kD and contains at least 41 polypeptide subunits, 7 of which are encoded in the mitochondria, the remaining subunits are encoded in the nucleus. The multisubunit NADH:ubiquinone oxidoreductase is the first enzyme complex. By use of chaotropic agents, complex I can be fragmented into 3 different fractions. The flavoprotein fraction contains the NDUFV1, NDUFV2, and NDUFV3 subunits. The iron-sulfur protein (IP) fraction contains at least 7 subunits, NDUFS1-NDUFS6 and NDUFA5. The remaining subunits are part of the hydrophobic protein (HP) fraction. NDUFA9 is part of the hydrophobic protein fraction of the enzyme complex. However, it is predominantly hydrophilic, and appears to lie mostly outside the lipid bilayer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52563
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
NBP1-87069
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-53421
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KO, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-87826
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-48671
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46127
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KO, WB
NB100-77279
Species: Hu, Mu
Applications: IP, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NBP1-90050
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
H00010043-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB

Publications for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP) (0)

There are no publications for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP) (0)

There are no reviews for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFA9 Products

Research Areas for NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP)

Find related products by research area.

Blogs on NDUFA9

There are no specific blogs for NDUFA9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NDUFA9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA9