NDUFA10 Antibody

Images

 
Western Blot: NDUFA10 Antibody [NBP2-57008] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: NDUFA10 Antibody [NBP2-57008] - Staining of human cell line HEK 293 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFA10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Specificity
Specificity of human NDUFA10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFA10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFA10 Recombinant Protein Antigen (NBP2-57008PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NDUFA10 Antibody

  • 10 (42kD)
  • CI-42k
  • CI-42KD
  • FLJ21923
  • MGC5103
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26161
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88934
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00055079-P01
Species: Hu
NBP1-90050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-09456
Species: Hu
MAB4415
Species: Hu
Applications: WB, ICC
NBP1-85871
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67334
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-25147
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80961
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88890
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57008
Species: Hu
Applications: WB, ICC/IF

Publications for NDUFA10 Antibody (NBP2-57008) (0)

There are no publications for NDUFA10 Antibody (NBP2-57008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA10 Antibody (NBP2-57008) (0)

There are no reviews for NDUFA10 Antibody (NBP2-57008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFA10 Antibody (NBP2-57008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NDUFA10 Antibody (NBP2-57008)

Discover related pathways, diseases and genes to NDUFA10 Antibody (NBP2-57008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA10 Antibody (NBP2-57008)

Discover more about diseases related to NDUFA10 Antibody (NBP2-57008).
 

Pathways for NDUFA10 Antibody (NBP2-57008)

View related products by pathway.

PTMs for NDUFA10 Antibody (NBP2-57008)

Learn more about PTMs related to NDUFA10 Antibody (NBP2-57008).

Blogs on NDUFA10

There are no specific blogs for NDUFA10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA10