NDUFA1 Antibody - Azide and BSA Free

Western Blot: NDUFA1 Antibody [H00004694-D01P] - Analysis of NDUFA1 expression in transfected 293T cell line by NDUFA1 polyclonal antibody.Lane 1: NDUFA1 transfected lysate(8.10 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDUFA1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NDUFA1 (AAH00266.1, 1 a.a. - 70 a.a.) full-length human protein. MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
• Specificity: NDUFA1 - NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA1 Antibody - Azide and BSA Free

• CI-MWFEcomplex I MWFE subunit
• Complex I-MWFE
• MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
• NADH oxidoreductase subunit MWFE
• NADH:ubiquinone oxidoreductase (complex 1)
• NADH-ubiquinone oxidoreductase MWFE subunit
• type I dehydrogenase
• ZNF183

Background

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA1
• Entrez:
  • 4694(Human)
• Uniprot:
  • AAH00266.1(Human)