NDRG4 Antibody - BSA Free

Western Blot: NDRG4 Antibody [NBP2-87888] - Host: Rabbit. Target Name: NDRG4. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NDRG4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDRG4 Antibody - BSA Free (NBP2-87888) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NDRG4. Peptide sequence: GYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTME The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDRG4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NDRG4 Antibody - BSA Free

• BDM1
• Brain development-related molecule 1
• DKFZp686I1615
• FLJ30586
• KIAA1180FLJ42011
• NDRG family member 4
• protein NDRG4
• SMAP-8MGC19632
• smooth muscle-associated protein 8
• Vascular smooth muscle cell-associated protein 8

Background

NDRG4 is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDRG4