NDRG4 Antibody - BSA Free

Western Blot: NDRG4 Antibody [NBP1-81434] - Analysis in control (vector only transfected HEK293T lysate) and NDRG4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: NDRG4 Antibody [NBP1-81434] - Staining in human cerebral cortex and pancreas tissues using anti-NDRG4 antibody. Corresponding NDRG4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NDRG4 Antibody [NBP1-81434] - Staining of human cerebellum shows moderate nuclear positivity in cells in molecular layer.

Immunohistochemistry-Paraffin: NDRG4 Antibody [NBP1-81434] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: NDRG4 Antibody [NBP1-81434] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDRG4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDRG4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDRG4 Protein (NBP1-81434PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19592488)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDRG4 Antibody - BSA Free

• BDM1
• Brain development-related molecule 1
• DKFZp686I1615
• FLJ30586
• KIAA1180FLJ42011
• NDRG family member 4
• protein NDRG4
• SMAP-8MGC19632
• smooth muscle-associated protein 8
• Vascular smooth muscle cell-associated protein 8

Background

NDRG4 is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDRG4 Antibody (NBP1-81434)(2)

Publications using NBP1-81434

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Schilling SH, Hjelmeland AB, Radiloff DR et al. NDRG4 Is Required for Cell Cycle Progression and Survival in Glioblastoma Cells. J Biol Chem 2009-09-11 [PMID: 19592488]

Bioinformatics

• Gene Symbol: NDRG4