NDFIP2 Antibody - BSA Free

Western Blot: NDFIP2 Antibody [NBP1-74110] - Titration: 1 ug/ml Positive Control: 293T Cells.

Western Blot: NDFIP2 Antibody [NBP1-74110] - Titration: 1.0 ug/ml Positive Control: Rat Lung.

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NDFIP2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the N terminal of Ndfip2. Immunizing peptide sequence YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDFIP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NDFIP2 Antibody - BSA Free

• FLJ25842
• KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07
• MAPK-activating protein PM04 PM05 PM06 PM07
• N4wbp5a
• Nedd4 family interacting protein 2
• NEDD4 family-interacting protein 2
• NEDD4 WW domain-binding protein 5A
• NF-kappa-B-activating protein 413
• Putative NF-kappa-B-activating protein 413

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDFIP2