Recombinant Human NCOR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NCOR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 2341-2440 of Human NCOR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NCOR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCOR1 Protein

  • hN-CoR
  • KIAA1047
  • KIAA1047N-CoR1
  • MGC104216
  • N-CoR
  • NCOR1
  • N-CoRhCIT529I10
  • nuclear receptor corepressor 1
  • nuclear receptor co-repressor 1
  • thyroid hormone- and retinoic acid receptor-associated corepressor 1
  • TRAC1

Background

NCOR1 - nuclear receptor co-repressor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009611-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NCOR1 Partial Recombinant Protein (H00009611-Q01) (0)

There are no publications for NCOR1 Partial Recombinant Protein (H00009611-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOR1 Partial Recombinant Protein (H00009611-Q01) (0)

There are no reviews for NCOR1 Partial Recombinant Protein (H00009611-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCOR1 Partial Recombinant Protein (H00009611-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCOR1 Products

Bioinformatics Tool for NCOR1 Partial Recombinant Protein (H00009611-Q01)

Discover related pathways, diseases and genes to NCOR1 Partial Recombinant Protein (H00009611-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOR1 Partial Recombinant Protein (H00009611-Q01)

Discover more about diseases related to NCOR1 Partial Recombinant Protein (H00009611-Q01).
 

Pathways for NCOR1 Partial Recombinant Protein (H00009611-Q01)

View related products by pathway.

PTMs for NCOR1 Partial Recombinant Protein (H00009611-Q01)

Learn more about PTMs related to NCOR1 Partial Recombinant Protein (H00009611-Q01).
 

Research Areas for NCOR1 Partial Recombinant Protein (H00009611-Q01)

Find related products by research area.

Blogs on NCOR1.

Muscular Dystrophy Regulation: Ezh2, NCoR-1
Over the years muscular dystrophies have become a popular area of research. These are a group of inherited disorders that involve an increase in muscle weakness over time. These disorders greatly decrease the quality of life and there are no known cur...  Read full blog post.

NCOR & EZH2 in Muscular Dystrophy
Over the years muscular dystrophies have become a popular area of research. These are a group of inherited disorders that involve an increase in muscle weakness over time. These disorders greatly decrease the quality of life and there are no known cur...  Read full blog post.

Customers Who Bought This Also Bought

NCOR1 Antibody
NB100-58824
HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NCOR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOR1
Entrez