NCK2 Antibody - BSA Free

Western Blot: NCK2 Antibody [NBP2-87886] - Host: Rabbit. Target Name: NCK2. Sample Tissue: PANC1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NCK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NCK2 Antibody - BSA Free (NBP2-87886) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NCK2. Peptide sequence: LGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NCK2 Antibody - BSA Free

• GRB4
• NCK adaptor protein 2cytoplasmic protein NCK2
• Nck-2
• NCKbeta
• noncatalytic region of tyrosine kinase, beta
• SH2/SH3 adaptor protein NCK-beta

Background

NCK2 encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCK2