| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clone | 8J2F6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 291-390 of human NCF1 (P14598). QRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | NCF1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NCF1 Antibody (NBP3-16572)Find related products by research area.
|
|
Identifying tumoral and stromal transcriptomes that underlie tumor plasticity and stromal neuroinflammatory response in brain metastasis By Jamshed Arslan, Pharm. D., PhD. Cancers in the brain often come from tumors elsewhere in the body. Several adaptive mechanisms influence brain metastasis, such as blood brain barrier leakage that can be induced by ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NCF1 |