NCCRP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NCCRP1 Antibody [NBP2-13642] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NCCRP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSW TVKQQCVDLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCCRP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NCCRP1 Protein (NBP2-13642PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCCRP1 Antibody

  • LOC342897
  • NCCRP-1
  • non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
  • nonspecific cytotoxic cell receptor protein 1 homolog
  • non-specific cytotoxic cell receptor protein 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
870-LP/CF
Species: Hu
BPI
7468-BP
Species: Hu
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-55046
Species: Hu
Applications: WB
AF2344
Species: Mu
Applications: WB, IHC, IP
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-13642
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NCCRP1 Antibody (NBP2-13642) (0)

There are no publications for NCCRP1 Antibody (NBP2-13642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCCRP1 Antibody (NBP2-13642) (0)

There are no reviews for NCCRP1 Antibody (NBP2-13642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NCCRP1 Antibody (NBP2-13642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCCRP1 Products

Bioinformatics Tool for NCCRP1 Antibody (NBP2-13642)

Discover related pathways, diseases and genes to NCCRP1 Antibody (NBP2-13642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NCCRP1 Antibody (NBP2-13642)

View related products by pathway.

Research Areas for NCCRP1 Antibody (NBP2-13642)

Find related products by research area.

Blogs on NCCRP1

There are no specific blogs for NCCRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCCRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCCRP1