NCCRP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NCCRP1 Antibody [NBP2-13642] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642] - Staining of human skin shows moderate positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642] - Staining of human cervix, uterine shows positivity in squamous epithelial cells.

Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.

Staining of human skin shows moderate positivity in squamous epithelial cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human cervix, uterine shows positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NCCRP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NCCRP1 Antibody - BSA Free (NBP2-13642) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-NCCRP1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCCRP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NCCRP1 Protein (NBP2-13642PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NCCRP1 Antibody - BSA Free

• LOC342897
• NCCRP-1
• non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)
• nonspecific cytotoxic cell receptor protein 1 homolog
• non-specific cytotoxic cell receptor protein 1 homolog

Background

Non-specific cytotoxic cells (NCCs) in teleosts and their evolutionary homologue are a subpopulation of lymphocytes with properties that distinguish them from either B- or T-cells. One such property is that NCC/natural killer (NK)/lymphokine activated killer (LAK) cells express spontaneous, non-major histocompatibility complex restricted cytotoxic activity. NCC and LAK lyse a variety of transformed murine and human B-cell, T-cell and myeloid targets. A 32 kDa membrane protein [non-specific cytotoxic cell receptor protein (NCCRP-1)] expressed by NCC and certain mammalian NK/LAK cells mediates this cytotoxicity. NCCRP-1 is evolutionarily conserved and is found in species ranging from marine and freshwater teleosts to higher mammals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NCCRP1 Antibody (NBP2-13642)(1)

Publication using NBP2-13642

• Jian Zhou, Weiwei Qian, Cuiliu Huang, Cunjun Mai, Yimei Lai, Zhiqin Lin, Guie Lai Combined targeting of KRT23 and NCCRP1 as a potential novel therapeutic approach for the treatment of triple-negative breast cancer. Gland surgery 2022-10-01 [PMID: 36353580]

FAQs for NCCRP1 Antibody (NBP2-13642). (Showing 1 - of FAQ).

Bioinformatics

• Gene Symbol: NCCRP1