NCCRP1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NCCRP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NCCRP1 Antibody - BSA Free
Background
Non-specific cytotoxic cells (NCCs) in teleosts and their evolutionary homologue are a subpopulation of lymphocytes with properties that distinguish them from either B- or T-cells. One such property is that NCC/natural killer (NK)/lymphokine activated killer (LAK) cells express spontaneous, non-major histocompatibility complex restricted cytotoxic activity. NCC and LAK lyse a variety of transformed murine and human B-cell, T-cell and myeloid targets. A 32 kDa membrane protein [non-specific cytotoxic cell receptor protein (NCCRP-1)] expressed by NCC and certain mammalian NK/LAK cells mediates this cytotoxicity. NCCRP-1 is evolutionarily conserved and is found in species ranging from marine and freshwater teleosts to higher mammals.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for NCCRP1 Antibody (NBP2-13642)(1)
Showing Publication 1 -
1 of 1.
Reviews for NCCRP1 Antibody (NBP2-13642) (0)
There are no reviews for NCCRP1 Antibody (NBP2-13642).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NCCRP1 Antibody (NBP2-13642). (Showing 1 - of FAQ).
Secondary Antibodies
| |
Isotype Controls
|
Additional NCCRP1 Products
Research Areas for NCCRP1 Antibody (NBP2-13642)
Find related products by research area.
|
Blogs on NCCRP1