NCAPH2 Antibody - BSA Free

Western Blot: NCAPH2 Antibody [NBP3-09338] - Western blot analysis using NBP3-09338 on Human HeLa as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NCAPH2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NCAPH2 Antibody - BSA Free (NBP3-09338) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2 (NP_689512). Peptide sequence EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCAPH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 68 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NCAPH2 Antibody - BSA Free

• CAP-H2 subunit of the condensin II complex
• CAP-H2
• CAPH2,384D8-2
• Chromosome-associated protein H2
• condensin-2 complex subunit H2
• hCAP-H2
• kleisin beta
• Kleisin-beta
• MGC15858
• MGC18000
• MGC2455
• MGC4133
• MGC5305
• MGC8640
• Non-SMC condensin II complex subunit H2
• non-SMC condensin II complex, subunit H2

Background

CAP-H2 (chromosome-associated protein H2) is 1 of 3 non-SMC subunits that define the condensin II complex. Condensin II along with the condensin I plays a critical role in mitotic chromosome assembly and segregation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCAPH2