HCAP-G Antibody

Images

 
Immunohistochemistry-Paraffin: HCAP-G Antibody [NBP1-88199] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HCAP-G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ETLTPEIALYWCALCEYLKSKGDEGEEFLEQILPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCAPG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HCAP-G Protein (NBP1-88199PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HCAP-G Antibody

  • CAP-G
  • CAPGHCAP-G
  • CHCG
  • chromosome condensation protein G
  • Chromosome-associated protein G
  • condensin complex subunit 3
  • Condensin subunit CAP-G
  • FLJ12450
  • hCAP-G
  • Melanoma antigen NY-MEL-3
  • MGC126525
  • Non-SMC condensin I complex subunit G
  • non-SMC condensin I complex, subunit G
  • NYMEL3
  • NY-MEL-3
  • XCAP-G homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82037
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85922
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86632
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89230
Species: Hu
Applications: WB, IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP1-31318
Species: Mu
Applications: IHC-P

Publications for HCAP-G Antibody (NBP1-88199) (0)

There are no publications for HCAP-G Antibody (NBP1-88199).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HCAP-G Antibody (NBP1-88199) (0)

There are no reviews for HCAP-G Antibody (NBP1-88199). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HCAP-G Antibody (NBP1-88199) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HCAP-G Products

Bioinformatics Tool for HCAP-G Antibody (NBP1-88199)

Discover related pathways, diseases and genes to HCAP-G Antibody (NBP1-88199). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HCAP-G Antibody (NBP1-88199)

Discover more about diseases related to HCAP-G Antibody (NBP1-88199).
 

Pathways for HCAP-G Antibody (NBP1-88199)

View related products by pathway.

PTMs for HCAP-G Antibody (NBP1-88199)

Learn more about PTMs related to HCAP-G Antibody (NBP1-88199).
 

Research Areas for HCAP-G Antibody (NBP1-88199)

Find related products by research area.

Blogs on HCAP-G

There are no specific blogs for HCAP-G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HCAP-G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAPG