Immunocytochemistry/ Immunofluorescence: MURF2 Antibody [NBP2-33691] - Staining of human cell line BJ shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human lymph node shows very weak positivity in subset of non-germinal center cells.
Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Novus Biologicals Rabbit MURF2 Antibody - BSA Free (NBP2-33691) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MURF2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM55
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for MURF2 Antibody - BSA Free
muRF2
MuRF-2
Muscle-specific RING finger protein 2
RING finger protein 29muscle specific ring finger 2
RNF29
tripartite motif containing 55
tripartite motif-containing 55
tripartite motif-containing protein 55
Background
MURF2 is encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MURF2 Antibody - BSA Free and receive a gift card or discount.