MURF2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MURF2 Antibody [NBP2-33691] - Staining of human cell line BJ shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human lymph node shows very weak positivity in subset of non-germinal center cells.

Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MURF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MURF2 Antibody - BSA Free (NBP2-33691) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MURF2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM55
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 30685767).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MURF2 Protein (NBP2-33691PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MURF2 Antibody - BSA Free

• muRF2
• MURF-2
• Muscle-specific RING finger protein 2
• RING finger protein 29muscle specific ring finger 2
• RNF29
• tripartite motif containing 55
• tripartite motif-containing 55
• tripartite motif-containing protein 55

Background

MURF2 is encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MURF2 Antibody (NBP2-33691)(2)

Publications using NBP2-33691

• Li WW, Yuan H, Kong S, Tian SB E3 ubiquitin ligase TRIM55 promotes metastasis of gastric cancer cells by mediating epithelial-mesenchymal transition World journal of gastrointestinal oncology 2022-11-15 [PMID: 36438697] (IHC-P, Human)
• Li X, Huang L, Gao W. Overexpression of Tripartite Motif Conaining 55 (TRIM55) Inhibits Migration and Invasion of Hepatocellular Carcinoma (HCC) Cells via Epithelial-Mesenchymal Transition and Matrix Metalloproteinase-2 (MMP2). Med. Sci. Monit. 2019-01-27 [PMID: 30685767] (WB, Human)

Bioinformatics

• Gene Symbol: TRIM55
• Uniprot:
  • Q9BYV6(Human)