MURF2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MURF2 Antibody [NBP2-33691] - Staining of human cell line BJ shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MURF2 Antibody [NBP2-33691] - Staining of human vulva/anal skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MURF2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM55
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 30685767).
Control Peptide
MURF2 Protein (NBP2-33691PEP)
Publications
Read Publication using
NBP2-33691 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 30685767).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MURF2 Antibody

  • muRF2
  • MURF-2
  • Muscle-specific RING finger protein 2
  • RING finger protein 29muscle specific ring finger 2
  • RNF29
  • tripartite motif containing 55
  • tripartite motif-containing 55
  • tripartite motif-containing protein 55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46224
Species: Hu, Mu, Rt
Applications: WB, IHC
AF5366
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, I, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP1-71703
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-02627
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-93304
Species: Hu, ChHa
Applications: WB, IP
NBP1-71927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30249
Species: Hu, Mu, Xp
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85439
Species: Hu
Applications: IHC, IHC-P

Publications for MURF2 Antibody (NBP2-33691)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MURF2 Antibody (NBP2-33691) (0)

There are no reviews for MURF2 Antibody (NBP2-33691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MURF2 Antibody (NBP2-33691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MURF2 Products

Bioinformatics Tool for MURF2 Antibody (NBP2-33691)

Discover related pathways, diseases and genes to MURF2 Antibody (NBP2-33691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MURF2 Antibody (NBP2-33691)

Discover more about diseases related to MURF2 Antibody (NBP2-33691).
 

Pathways for MURF2 Antibody (NBP2-33691)

View related products by pathway.

PTMs for MURF2 Antibody (NBP2-33691)

Learn more about PTMs related to MURF2 Antibody (NBP2-33691).
 

Research Areas for MURF2 Antibody (NBP2-33691)

Find related products by research area.

Blogs on MURF2

There are no specific blogs for MURF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MURF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM55
Uniprot