CD300c Antibody

Western Blot: CD300c/LMIR2 Antibody [NBP1-84432] - Analysis in control (vector only transfected HEK293T lysate) and CD300C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: CD300c/LMIR2 Antibody [NBP1-84432] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CD300c Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD300C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD300c Recombinant Protein Antigen (NBP1-84432PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD300c Antibody

• CD300c antigenCMRF35 antigen
• CD300c molecule
• CD300c
• CLM6
• CLM-6
• CMRF35 leukocyte immunoglobulin-like receptor
• CMRF35
• CMRF-35
• CMRF35A leukocyte immunoglobulin-like receptor
• CMRF-35A
• CMRF35ACMRF35A1
• CMRF35CMRF35-A1
• CMRF35-like molecule 6
• IGSF16
• IgSF16
• IGSF16CD300 antigen-like family member C
• Immunoglobulin superfamily member 16
• LIR

Background

CD300C - CD300C antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CD300c Antibody (NBP1-84432)(1)

Publication using NBP1-84432

• Cui C, Su M, Lin Y, Lai L. A CD300c-Fc Fusion Protein Inhibits T Cell Immunity. Front Immunol. 2018-11-15 [PMID: 30498497] (WB, Human)

FAQs for CD300c Antibody (NBP1-84432). (Showing 1 - 1 of 1 FAQ).

1. Why are there different molecular weight bands in western blot images for two of your antibodies (NBP1-84432 and H00010871-B01P) and overexpression lysate NBL1-08931?
   • A variety of band patterns can be expected when detecting CD300C. This protein has multiple glycosliation post-translational modifications that will change its molecular weight, and which vary in different experimental conditions. If you look at the uniprot link listed below, you can view more information on the specific PTMs for CD300C:https://www.uniprot.org/uniprot/Q08708#sequencesWe can be assured that these varying band patterns are indeed detection of CD300C by the absence of bands in the negative control. Any non-specific binding would show in both the negative and positive control, which is not the case here.

Bioinformatics

• Gene Symbol: CD300C