Recombinant Human NAT8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NAT8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-227 of Human NAT8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPCHVRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NAT8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NAT8 Protein

  • Camello-like protein 1
  • CML1
  • EC 2.3.1
  • EC 2.3.1.-
  • GLAkidney- and liver-specific gene product
  • Hcml1
  • N-acetyltransferase 8 (GCN5-related, putative)
  • N-acetyltransferase 8
  • probable N-acetyltransferase 8
  • TSC501N-acetyltransferase 8 (camello like)
  • TSC510

Background

NAT8( AAH12626, 1 a.a. - 228 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-45844
Species: Hu
Applications: WB, IHC
MAB22441
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-35213
Species: Hu
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
355-BM/CF
Species: Hu, Mu, Rt
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
H00009027-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NAT8 Recombinant Protein (H00009027-P01) (0)

There are no publications for NAT8 Recombinant Protein (H00009027-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAT8 Recombinant Protein (H00009027-P01) (0)

There are no reviews for NAT8 Recombinant Protein (H00009027-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAT8 Recombinant Protein (H00009027-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NAT8 Products

Bioinformatics Tool for NAT8 Recombinant Protein (H00009027-P01)

Discover related pathways, diseases and genes to NAT8 Recombinant Protein (H00009027-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAT8 Recombinant Protein (H00009027-P01)

Discover more about diseases related to NAT8 Recombinant Protein (H00009027-P01).
 

Pathways for NAT8 Recombinant Protein (H00009027-P01)

View related products by pathway.

PTMs for NAT8 Recombinant Protein (H00009027-P01)

Learn more about PTMs related to NAT8 Recombinant Protein (H00009027-P01).

Blogs on NAT8

There are no specific blogs for NAT8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NAT8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NAT8