NAPRT1 Recombinant Protein Antigen

Images

 
There are currently no images for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NAPRT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAPRT1.

Source: E. coli

Amino Acid Sequence: LLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NAPRT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-52924. Protein

was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NAPRT1 Recombinant Protein Antigen

  • EC 2.4.2.11
  • FHA-HIT-interacting protein
  • FHIP
  • NAPRTase
  • nicotinate phosphoribosyltransferase domain containing 1
  • Nicotinate phosphoribosyltransferase domain-containing protein 1
  • nicotinate phosphoribosyltransferase
  • nicotinic acid phosphoribosyltransferase
  • PP3856

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23795
Species: Hu, Rt
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
AF1049
Species: Hu
Applications: WB, IHC
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02860
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94745
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86108
Species: Hu
Applications: WB, IHC, IHC-P
H00006999-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-49350
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-67593
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50045
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-52924PEP
Species: Hu
Applications: AC

Publications for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP) (0)

There are no publications for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP) (0)

There are no reviews for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional NAPRT1 Products

Bioinformatics Tool for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP)

Discover related pathways, diseases and genes to NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP)

Discover more about diseases related to NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP).
 

Pathways for NAPRT1 Recombinant Protein Antigen (NBP2-52924PEP)

View related products by pathway.

Blogs on NAPRT1

There are no specific blogs for NAPRT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NAPRT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NAPRT1