| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse Nanos2 Antibody - Azide and BSA Free (H00339345-B01P) is a polyclonal antibody validated for use in WB. Anti-Nanos2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | NANOS2 (NP_001025032, 1 a.a. - 138 a.a.) full-length human protein. MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | NANOS2 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for Western Blot |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
| Publication using H00339345-B01P | Applications | Species |
|---|---|---|
| Barrios F, Filipponi D, Pellegrini M et al. Opposing effects of retinoic acid and FGF9 on Nanos2 expression and meiotic entry of mouse germ cells. J Cell Sci;123(Pt 6):871-80. 2010-03-15 [PMID: 20159962] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Nanos2 Antibody (H00339345-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NANOS2 |
| Uniprot |
|