NALP12 Recombinant Protein Antigen

Images

 
There are currently no images for NALP12 Protein (NBP1-85555PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NALP12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP12.

Source: E. coli

Amino Acid Sequence: LKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NLRP12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85555.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NALP12 Recombinant Protein Antigen

  • FCAS2
  • Monarch-1
  • NACHT, leucine rich repeat and PYD containing 12
  • NACHT, LRR and PYD domains-containing protein 12
  • NALP12LRR and PYD containing protein 12
  • NLR family, pyrin domain containing 12
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 12
  • PYPAF7Monarch1
  • PYRIN-containing APAF1-like protein 7
  • Regulated by nitric oxide
  • RNO2

Background

NALPs are cytoplasmic proteins that form a subfamily within the larger CATERPILLER protein family. Most short NALPs, such as NALP12, have an N-terminal pyrin (MEFV; MIM 608107) domain (PYD), followed by a NACHT domain, a NACHT-associated domain (NAD), and a C-terminal leucine-rich repeat (LRR) region. The long NALP, NALP1 (MIM 606636), also has a C-terminal extension containing a function to find domain (FIIND) and a caspase recruitment domain (CARD). NALPs are implicated in the activation of proinflammatory caspases (e.g., CASP1; MIM 147678) via their involvement in multiprotein complexes called inflammasomes. NALP12 may mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-56155
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-54899
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NBP1-39681
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC,  IHC-P, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-78979
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P
AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NBP1-77068
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB

Publications for NALP12 Protein (NBP1-85555PEP) (0)

There are no publications for NALP12 Protein (NBP1-85555PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NALP12 Protein (NBP1-85555PEP) (0)

There are no reviews for NALP12 Protein (NBP1-85555PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NALP12 Protein (NBP1-85555PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NALP12 Products

Research Areas for NALP12 Protein (NBP1-85555PEP)

Find related products by research area.

Blogs on NALP12.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NALP12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP12