NAD Synthetase Antibody

Immunocytochemistry/Immunofluorescence: NAD Synthetase Antibody [NBP2-58373] - Staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: NAD Synthetase Antibody [NBP2-58373] - Staining of human rectum shows cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NAD Synthetase Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ANEGNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWTPHSPHIDMGLDGVEIITNASGSHHVLRKANTRVDLVTMVTSKNGGIY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NADSYN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NAD Synthetase Recombinant Protein Antigen (NBP2-58373PEP)

Reactivity Notes

Mouse 89%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NAD Synthetase Antibody

• EC 6.3.5.1
• FLJ10631
• FLJ36703
• FLJ40627
• glutamine-dependent NAD synthetase
• glutamine-dependent NAD(+) synthetase
• NAD synthetase 1
• NAD(+) synthase [glutamine-hydrolyzing]
• NAD(+) synthase
• NAD(+) synthetase

Background

Nicotinamide adenine dinucleotide (NAD) is a coenzyme in metabolic redox reactions, a precursor for several cell signaling molecules, and a substrate for protein posttranslational modifications. NAD synthetase (EC 6.3.5.1) catalyzes the final step in the biosynthesis of NAD from nicotinic acid adenine dinucleotide (NaAD).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NADSYN1