NAB1 Antibody - BSA Free

Western Blot: NAB1 Antibody [NBP2-87876] - WB Suggested Anti-NAB1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Transfected 293T

Immunohistochemistry: NAB1 Antibody [NBP2-87876] - Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-NAB1 antibody

Immunohistochemistry: NAB1 Antibody [NBP2-87876] - Human Intestine

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NAB1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human NAB1. Peptide sequence: ALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSPTWLGISCSSYERSSNA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NAB1 Antibody - BSA Free

• EGR1 binding protein 1
• EGR-1-binding protein 1
• NGFI-A binding protein 1 (EGR1 binding protein 1)
• NGFI-A-binding protein 1
• Transcriptional regulatory protein p54

Background

NAB1 acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAB1