N-PAC Antibody - BSA Free

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38576] - Staining of human cerebral cortex, colon, kidney and testis using Anti-GLYR1 antibody NBP2-38576 (A) shows similar protein distribution across tissues to independent antibody NBP2-38618 (B).

Immunocytochemistry/Immunofluorescence: N-PAC Antibody [NBP2-38576] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38576] - Staining of human kidney.

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38576] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38576] - Staining of human testis.

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38576] - Staining of human colon.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

N-PAC Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit N-PAC Antibody - BSA Free (NBP2-38576) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSD
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLYR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  N-PAC Protein (NBP2-38576PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for N-PAC Antibody - BSA Free

• BM045
• Cytokine-like nuclear factor N-PAC
• glyoxylate reductase 1 homolog (Arabidopsis)
• Glyoxylate reductase 1 homolog
• HIBDLnuclear protein 60 kDa
• NP603-hydroxyisobutyrate dehydrogenase-like protein
• N-PAC
• nuclear protein 60kDa
• Nuclear protein NP60
• Nuclear protein of 60 kDa
• putative oxidoreductase GLYR1

Background

N-PAC may have oxidoreductase activity. Regulates p38 MAP kinase activity by mediating stress activation ofp38alpha/MAPK14 and specifically regulating MAPK14 signaling. Indirectly promotes phosphorylation of MAPK14 andactivation of ATF2. The phosphorylation of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLYR1
• Uniprot:
  • Q49A26(Human)